Conserved Protein Domain Family
COX2

?
MTH00076: COX2 
cytochrome c oxidase subunit II; Provisional
Statistics
?
PSSM-Id: 164646
View PSSM: MTH00076
Aligned: 54 rows
Threshold Bit Score: 428.044
Threshold Setting Gi: 240266588
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62161200    1 MAHPSQLGFQDAASPIMEELLHFHDHALMAVFLISTLVLYIITVMMTTKLTNTNAMDAQEIEMVWTIMPAIILIVIALPS 80 
164519155   1 MAHPLQLGFQDAASPIMEELLHFHDHALMAVFLISALVLYIITTLMSTKLSNTNTIDAQEIEMVWTIMPAIILIVIALPS 80 
55583402    1 MAHPTQLGFQDAASPIMEELLHFHDHTLMAVFLISTLVLYIITSLMTTKLSSTNTIDAQEIEMVWTIMPAIILIVIALPS 80 
55583430    1 MAHPLQLGFQDAASPIMEELLHFHDHALMAVFLISALVLYIITTLMSTNLSNTNTIDAQEIEMVWTIMPAIILIVIALPS 80 
157939557   1 MAHPLQLGFQDAASPIMEELLHFHDHALMAVFLISTLVLYIISTLMSTKLSNTNTIDAQEIEMVWTIMPAIILIVIALPS 80 
115494667   1 MAHPLQLGFQDAASPIMEELLHFHDHTLMAVFLISTLVLYIISTLMSTKLSNTNTIDAQEIEMVWTIMPAIILIVIALPS 80 
164519183   1 MAHPTQLGFQDAASPIMEELLHFHDHTLMAVFLISTLVLYIITSLMTTKLSSTNTIDAQEIEMVWTIMPAIILIVIALPS 80 
162374608   1 MAHPLQLGFQDAASPIMEELLHFHDHTLMAVFLISTLVLYIISTLMSTKLSNTNTIDAQEIEMVWTIMPAIILIVIALPS 80 
146149041   1 MAHPTQLGFQDAASPIMEELLHFHDHTLMAVFLISTLVLYIITSLMTTKLSSTNTIDAQEIEMVWTIMPAIILIVIALPS 80 
260150639   1 MAYPTQLGLQDAISPIMEELLHFHDHALMAVLLISMLVLYIIVTLMTTELSSTNTIDAQEIEMIWTIMPAIILIVIALPS 80 
62161200   81 LRILYLMDEINDPHLTVKAIGHQWYWSYEYTNYDDLVFDSYMLPTQNLNPGEFRLLEVDNRMVVPMESPIRMLISAEDVL 160
164519155  81 LRILYLMDEMSNPDITVKAIGHQWYWSYEYSDFANLSFDSYMVPTKDLLPGQFRLLEVDNRMVTPVGMATRTLITADDVL 160
55583402   81 LRILYLMDEISNPDITVKAIGHQWYWSYEYSDFANLNFDSYMIPTKELTPGQFRLLEVDNRMVTPIGMSTRTIITADDVL 160
55583430   81 LRILYLMDEMSNPDITIKAIGHQWYWSYEYSDFANLNFDSYMIPTQDLSLGQFRLLEVDNRMITPVGMATRTLITADDVL 160
157939557  81 LRILYLMDEVNNPDVTIKAIGHQWYWSYEYSDFNDLGFDSYMIPSKDLLPGQFRLLEVDNRMTTPVGMTTRTLITAEDVL 160
115494667  81 LRILYLMDEVSNPDVTIKAIGHQWYWSYEYSDFNDLSFDSYMIPSKDLLPGQFRLLEVDNRMTTPVGMTTRTLITAEDVL 160
164519183  81 LRILYLMDEISNPDITVKAIGHQWYWSYEYSDFANLNFDSYMVPTKELTPGQFRLLEVDNRMVTPIGMSTRAIITADDVL 160
162374608  81 LRILYLMDEVSNPDVTVKAIGHQWYWSYEYSDFNNLSFDSYMVPTKDLLPGQFRLLEVDNRMTTPVGMTTRTLITAEDVL 160
146149041  81 LRILYLMDEISNPDMQLKPLAHQWYWSYEYSDFANLNFDSYMIPTKELTPGQFRLLEVDNRMVTPIGMATRTIITADDVL 160
260150639  81 LRILYLMDEISSPDMTIKTVGHQWYWSYEYSDFTDLNFDSYMTPSNDLIPGQFRLLEVDNRMVTPIGTVTRTIVTAEDVL 160
62161200  161 HSWAMPSMGIKTDAIPGRLNQTTFIASRPGVFYGQCSEICGANHSFMPIVVETTPLGHFQNWSSSMQE 228
164519155 161 HSWAVPSLGVKTDAIPGRLSEASFLVSRPGVYYGQCSEICGANHSFMPIVIESLPIKEFLDWSSASET 228
55583402  161 HSWAVPSLGVKTDAIPGRLNQASFLVSRPGVYYGQCSEICGANHSFMPIVVEALPVPDFLNWSLISQD 228
55583430  161 HSWAVPSLGVKTDAIPGRLSEASFLVSRPGVYYGQCSEICGANHSFMPIVVESLPIKEFLDWSSASET 228
157939557 161 HSWAVPSLGVKLDAIPGRLNQTSFIISRPGVYYGQCSEICGANHSFMPIVVESLPIKEFLNWSSASVS 228
115494667 161 HSWAVPSLGVKLDAIPGRLNQTSFIISRPGVYYGQCSEICGANHSFMPIVVESLPIKEFLNWSSASVN 228
164519183 161 HSWAVPSLGVKTDAIPGRLNQTSFLISRPGVYYGQCSEICGANHSFMPIVVEALPVPDFLNWSLISQD 228
162374608 161 HSWAVPSLGVKLDAIPGRLNQTSFIISRPGVYYGQCSEICGANHSFMPIVVESLPIKEFLNWSSASVD 228
146149041 161 HSWAVPSLGVKTDAIPGRLNQASFLVSRPGVYYGQCSEICGANHSFMPIVVEALPVPDFLNWSLISQD 228
260150639 161 HSWAVPALGVKTDAIPGRLNQTSFLIAHPGVYYGQCSEICGANHSFMPIVVEALPVPNFLNWLSSHNE 228
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap