Conserved Protein Domain Family
COX3

?
MTH00075: COX3 
cytochrome c oxidase subunit III; Provisional
Statistics
?
PSSM-Id: 177146
View PSSM: MTH00075
Aligned: 63 rows
Threshold Bit Score: 443.417
Threshold Setting Gi: 53686509
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
53686565    1 MTHQAHAFHMVDPSPWPLTGAIAALLLTSGLMMWFHFGSVVLMNLGLIIMILTMIQWWRDIIRESTFQGHHTPPVQKGLR 80 
146149044   1 MAHQAHAYHMVDPSPWPLTGAAAAFLLTSGLAMWFHFNTIVLMTLGLLLMLLTMFQWWRDVVREGTFQGHHTPPVQKGLR 80 
115494670   1 MAHQAHAFHMVDPSPWPLTGATAAFMLTTGLAMWFHYGSTWILLLGLTLMLLTMFQWWRDVVREGTFQGHHTTPVQKGLR 80 
162374611   1 MAHQAHAFHMVDPSPWPLTGATAAFMLTTGLAMWFHYGSTWILFLGLTLMLLTMYQWWRDVVREGTFQGHHTIPVQKGLR 80 
164519186   1 MAHQAHAYHMVDPSPWPLTGAAAAFLLTSGLAMWFHYNTVIIMILGLLLMLLTMFQWWRDVVREGTFQGHHTPPVQKGLR 80 
164519158   1 MAHQAHAFHMVDPSPWPLTGATAAFMLTTGLAMWFHYNTVLILTSGLVLMLLTMYQWWRDVVREGTFQGHHTIPVQKGLR 80 
55583405    1 MAHQAHAYHMVDPSPWPLTGAAAAFLLTSGLAMWFHFNTMILMILGLILMLLTMFQWWRDVVREGTFQGHHTPPVQKGLR 80 
157939560   1 MAHQAHAFHMVDPSPWPLTGATAAFMLTTGLAMWFHYGSTWILLLGLTLMLLTMFQWWRDVVREGTFQGHHTTPVQKGLR 80 
55583447    1 MAHQAHAFHMVDPSPWPLTGAAAAFLLTSGLAMWFHFNTITLMLMGLTLMLLTMYQWWRDVVREGTFQGHHTPPVQKGLR 80 
47777259    1 MAHQAHAFHMVNPSPWPLTGASAAFLLTCGLAMWFHFNSTITLSMGLSLMLLTMYQWWRDVVREGTFQGHHTPPVQKGLR 80 
53686565   81 YGMVLFITSEVLFFFGFFWAFYNSSLAPTPELGECWPPMGISPLDPFEVPLLNTAVLLASGVTVTWTHHSIMEGQHKEAT 160
146149044  81 YGMILFITSEVFFFVGFFWAFYNASLSPTPEIGECWPPTGITPLDPFEVPLLNTAVLLASGVSVTWAHHSIMQGDRKGAI 160
115494670  81 YGMILFITSEVFFFIGFFWAFYNASLAPTFEVGECWPPAGISPLNPFEVPLLNTAVLLASGVTVTWAHHSIMQGNRKEAI 160
162374611  81 YGMILFITSEVFFFIGFFWAFYNASLAPTFEVGECWPPAGISPLNPFEVPLLNTAVLLASGVTVTWAHHSIMQGNRKEAI 160
164519186  81 YGMILFITSEVFFFIGFFWAFYNASLSPTPEIGECWPPAGISPLDPFEVPLLNTAVLLASGVSVTWAHHSIMQGDRKGTI 160
164519158  81 YGMILFITSEVFFFIGFFWAFYNASLAPSYEIGECWPPTGISPLNPFEVPLLNTAVLLASGVSVTWAHHSIMQGNRKEAI 160
55583405   81 YGMILFITSEVFFFIGFFWAFYNASLSPTPEIGECWPPTGITPLDPFEVPLLNTAVLLASGVSVTWAHHSIMQGDRKGAI 160
157939560  81 YGMILFITSEVFFFIGFFWAFYNASLAPTFEVGECWPPAGISPLNPFEVPLLNTAVLLASGVTVTWAHHSIMQGNRKEAI 160
55583447   81 YGMILFITSEVFFFIGFFWAFYNASLSPTPDIGECWPPTGITPLNPFEVPLLNTAVLLASGVSVTWAHHSIMQGDRKGAI 160
47777259   81 YGMILFITSEVFFFLGFFWAFYNASLAPTAEVGECWPPTGITPLNPFEVPLLNTAVLLASGVSVTWAHHSIMQSDRKSTI 160
53686565  161 QSLLLTIILGLYFTLLQAMEYYEAPFTIADGVYGSTFFVATGFHGLHVIIGSSFLLVCLLRQINFHFTSSHHFGFEAAAW 240
146149044 161 QALALTIILGGYFTLLQAMEYYEAPFTIADGIYGSTFFVATGFHGLHVIIGSVFLFTCLLRQINFHFTSQHHFGFEAAAW 240
115494670 161 QSLALTIVLGLYFTALQAMEYYEAPFTIADGIYGSTFFVATGFHGLHVIIGSLFLLTCLLRQINFHFTAQHHFGFEAAAW 240
162374611 161 QSLALTIILGLYFTALQAMEYYEAPFTIADGIYGSTFFVATGFHGLHVIIGSLFLLTCLLRQISFHFTAQHHFGFEAAAW 240
164519186 161 QALTLTIILGTYFTMLQAMEYYEAPFTIADGIYGSTFFVATGFHGLHVIIGSIFLLTCLLRQISFHFTSQHHFGFEAAAW 240
164519158 161 QSLTLTIVLGLYFTALQAMEYYEAPFTIADGIYGSTFFVATGFHGLHVIIGSLFLLTCLLRQINYHFTTQHHFGFEAAAW 240
55583405  161 QSLTLTIILGAYFTLLQAMEYYEAPFTIADGIYGSTFFVATGFHGLHVIIGSVFLLTCLLRQINFHFTSQHHFGFEAAAW 240
157939560 161 QSLTLTIVLGLYFTALQAMEYYEAPFTIADGIYGSTFFVATGFHGLHVIIGSLFLLTCLLRQINFHFTAQHHFGFEAAAW 240
55583447  161 QALALTILLGLYFTVLQAMEYYEAPFTIADGIYGSTFFVATGFHGLHVIIGTLFLLTCLLRQINFHFTSQHHFGFEAAAW 240
47777259  161 QALMLTIILGLYFTALQAMEYYEAPFTIADGIYGTTFFVATGFHGLHVIIGTLFLLTCLLRQMLFHLTTQHHFGFEAAAW 240
53686565  241 YWHFVDVVWLFLYISIYWWGS 261
146149044 241 YWHFVDVVWLFLYVSIYWWGS 261
115494670 241 YWHFVDVVWLFLYVSIYWWGS 261
162374611 241 YWHFVDVVWLFLYVSIYWWGS 261
164519186 241 YWHFVDVVWLFLYVSIYWWGS 261
164519158 241 YWHFVDVVWLFLYVSIYWWGS 261
55583405  241 YWHFVDVVWLFLYVSIYWWGS 261
157939560 241 YWHFVDVVWLFLYVSIYWWGS 261
55583447  241 YWHFVDVVWLFLYVSIYWWGS 261
47777259  241 YWHFVDVVWLFLYVSIYWWGS 261
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap