Conserved Protein Domain Family
CYTB

?
MTH00074: CYTB 
cytochrome b; Provisional
Statistics
?
PSSM-Id: 177145
View PSSM: MTH00074
Aligned: 66 rows
Threshold Bit Score: 664.073
Threshold Setting Gi: 53686515
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
53686361    1 MAHTMRKTHPLLKIINNSFIDLPTPSNISYLWNFGSLLGICLISQIITGLFLAMHYTADTTSAFSSVAHICRDVNYGWVM 80 
55583371    1 MLMNPRKTHPILKIINNSFIDLPSPSNISSLWNFGSLLGICLISQIITGLFLAMHYTADTTSAFSSVAHICRDVNYGWLM 80 
52551374    1 MTHNIRKTHPLLKIINNSFIDLPSPSNISSLWNFGSLLGLCLVSQIITGLFLAMHYTADTTSAFSSVVHICRDVNYGWLM 80 
52550952    1 -MINTRKTHPIFKIINNSFIDLPSPSNISSLWNFGSLLGICLISQIITGLFLAMHYTADTTSAFSSVAHICRDVNYGWLM 79 
58045576    1 MAPNLRKSHPLIKIINNSFIDLPAPSNISYLWNFGSLLGVCLIAQILTGLFLAMHYTADTSMAFSSVAHICRDVNYGWLI 80 
58618677    1 MAPNIRKSHPLIKIVNNSFIDLPTPSNLSSWWNFGSLLGVCLIAQIATGLFLAMHYTADTSMAFSSVAHICRDVNYGWLI 80 
194246893   1 MAPNLRKSHPLVKIINGSFIDLPAPSNISVWWNFGSLLGICLIIQILTGLFLAMHYTADTTMAFSSVAHICRDVNYGWLI 80 
5834994     1 MAPNIRKSHPLIKIINNSFIDLPTPSNISSLWNFGSLLGVCLIAQIITGLFLAMHYTADTSMAFSSVAHICFDVNYGLLI 80 
52459788    1 MLPIIRKSHPILKIINNSFIDLPTPSNLSSLWNYGSLLGICLIMQITTGLFLAMHYTADTSMAFSSVAHICRDVNYGWLM 80 
58047419    1 MAPNIRKSHPLIKIVNNSFIDLPTPSNISALWNFGSLLGVCLIAQILTGLFLAMHYTADTSMAFSSIAHICRDVNYGWLI 80 
53686361   81 RNIHANGASFFFICIYMHIGRGIYYGSYMYKETWNIGVILLFLVMATAFVGYVLPWGQMSFWGATVITNLLSAIPYMGDM 160
55583371   81 RNIHANGASMFFICIYLHIGRGIYYGSYLFKETWNIGVILLLLVMATAFVGYVLPWGQMSFWGATVITNLLSAIPYIGNM 160
52551374   81 RNLHANGASMFFICIYIHIGRGIYYGSYLFKETWNIGILLLLLVMATAFVGYVLPWGQMSFWGATVITNLLSATPYIGDT 160
52550952   80 RNIHANGASMFFICIYMHIGRGIYYGSYLYKETWNIGVLLLFLVMATAFVGYVLPWGQMSFWGATVITNLLSAMPYVGDM 159
58045576   81 RNLHANGASFFFICIYLHIGRGMYYGSFMYKETWNVGVILLFLVMATAFVGYVLPWGQMSFWGATVITNLLSAVPYMGNT 160
58618677   81 RNLHANGASFFFICIYLHIGRGLYYGSFLYKETWNIGVILLFLVMATAFVGYVLPWGQMSFWGATVITNLLSAIPYIGNV 160
194246893  81 RNLHANGASFFFICIYFHIGRGIYYGSFLFKETWNIGVVLLFLVMATAFVGYVLPWGQMSFWGATVITNLLSAIPYVGTT 160
5834994    81 RNLHANGLSFFFICIYLHIGRGLYYGSFLYKETWNIGVILLFLVMATAFVGYVLPWGQMSFWGATVITNLLSAKPYIGNV 160
52459788   81 RNIHANGASLFFICIYLHIGRGIYYGSYLYKETWNIGVILLLLLMATAFVGYVLPWGQMSFWGATVITNLLSATPYIGNN 160
58047419   81 RNLHANGASFFFICIYLHIGRGLYYGSYLFKETWNIGVILLFLVMATAFVGYVLPWGQMSFWGATVITNLLSAIPYIGNM 160
53686361  161 LVQWIWGGFSVDKATLTRFFAFHFILPFIVSGASIIHLIFLHETGSNNPTGLNSNPDKIPFHPYFSYKDMLGFLIMLFSL 240
55583371  161 LVQWIWGGFSVDKATLTRFFSFHFILPFLIIGMSILHLIFLHETGSNNPTGLNSNTDKIPFHPYFSYKDLLGFMIMLSLL 240
52551374  161 LVQWIWGGFSIDKATLTRFFSFHFILPFLIAGMSALHLLFLHETGSNNPTGLNSNIDKIPFHPYFSYKDTLGFMMMFTML 240
52550952  160 LVQWIWGGFSVDKATLTRFFSFHFILPFLIIGMSILHLIFLHETGSNNPTGLNSDTDKIPFHPYFSYKDALGFMIMLSLL 239
58045576  161 LVQWIWGGFSVDNATLTRFFAFHFLLPFAIAGASILHLLFLHQTGSNNPTGLNSNPDKVQFHPYFSYKDLLGFLIMLTAL 240
58618677  161 LVQWIWGGFSVDNATLTRFFAFHFLLPFLIAGASILHLLFLHETGSTNPTGLNSDPDKIPFHPYFSYKDLLGFLIMLTSL 240
194246893 161 LVQWIWGGFSVDNATLTRFFAFHFLLPFVIAGATILHLLFLHETGSNNPTGLNSNTDKIPFHPYFSYKDLLGFLIMLTTL 240
5834994   161 LVQWSLGGFSVDNATLTRFFAFHFLLPFIIAGASILHLLFLHETGSTNPTGLNSDPDKVPFHPYFSYKDLLGFLIMLTAL 240
52459788  161 LVQWIWGGFSVDNATLTRFFAFHFILPFLISGASMIHLIFLHETGSNNPTGLNSNMDKITFHPYLSYKDFLGFILLLSML 240
58047419  161 LVQWIWGGFSVDNATLTRFFAFHFLLPFVIAGAAIPHLLFLHGTGSNNPTGLNSNLEKVPFHPYFSYKDLLGFLIMLSAL 240
53686361  241 MALSLLSPNLLSDPENFTPANPLVTPPHIQPEWYFLFAYAILRSIPNKLGGVMALLASILILMIIPILHSSKHRSFTFRP 320
55583371  241 SSMALFCPNLLGDPENFTPANPLMTPPHIKPEWYFLFAYAILRSIPNKLGGVLALLFSILILFVIPMLHTSKQRAMTFRP 320
52551374  241 AIISLFSPNLLGDPENFSPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALLFSILVLFSIPSLHTSKQRAMTFRP 320
52550952  240 AIMSMFFPNILGDPENFTPANPLMTPPHIKPEWYFLFAYAILRSIPNKLGGVMALLLSILILFFVPILHTSKQRTMTFRP 319
58045576  241 AMLAMFSPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALVFSILILALMPILHTAKQRSLMFRP 320
58618677  241 TLLAMFAPNLLGDPENFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALVFSILILALMPLLHTSKQRSLMFRP 320
194246893 241 ALLAMFSPNLLGDPDNFTPANPLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALVFSILILALLPLLHTAKQRSLMFRP 320
5834994   241 TLLAMFSPNLLGDPDNFTPANPLITPPHIKPEWYFLFAYAILRSM-NKLGGVLALVLSILILALMPLLHTSKQRSLMFRP 319
52459788  241 MLLASFYPNLLSDPENFTPANPLLTPPHIKPEWYFLFAYAILRSIPNKLGGVLALLFPILILMFIPSLHTAKQRSMTFRP 320
58047419  241 TLLAMFSPNLLGDPDNFTPANQLVTPPHIKPEWYFLFAYAILRSIPNKLGGVLALVSSILILALMPLLRTAKQRSLIFRP 320
53686361  321 TTQTLFWLLIANTLVLTWIGGQPVEPPFIEIGQVASILYFTLFLLLIPIFGMMENKLMKW 380
55583371  321 ITQMMFWLTTANMMILTWIGGQPVEEPFILIGQVSSVVYFMLFIILIPLTGLAENKSLNY 380
52551374  321 FTKTVFWLIVTNTLILTWIGGQPVEEPFIMIGQISSSIYFMLFILFLPLTGLLENKMLNW 380
52550952  320 ITQLMFWSIVANTIILTWIGGQPVEEPFITIGQISSILYFLLFIMLLPLIALAENKMLNW 379
58045576  321 LTQTLFWALVADTLILTWIGGQPVEDPYIMIGQVASVLYFLIFLAMIPATGLLENKLLNW 380
58618677  321 LTQITFWALVADTLILTWIGGQPVEDPYIMIGQLASVIYFAIFLVLIPTIGWVENKLLNW 380
194246893 321 ITQIIFWSLIADTLILTWIGGQPVEDPFILIGQVASLIYFFIFLILFPLSGWLENKLLNW 380
5834994   320 FTQIMFWALVADTLILTWIGGQPVEDPYTMIGQLASVIYFSIFIIMFPLMGWVENKLLNW 379
52459788  321 ITQLLFWSIIANTIILTWIGGQPVEDPFIMIGQMASMLYFIFFILVFPLTGLLENKMLNL 380
58047419  321 ITQALFWALVADTLILTWIGGQPVEDPFIMVGQVASAVYFTIFILLIPTSGWLENKLLNW 380
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap