Conserved Protein Domain Family
ATP6

?
MTH00073: ATP6 
ATP synthase F0 subunit 6; Provisional
Statistics
?
PSSM-Id: 177144
View PSSM: MTH00073
Aligned: 69 rows
Threshold Bit Score: 279.159
Threshold Setting Gi: 13936185
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
53686495    1 MSLSFFDQFMSPILMGVPLITLSLLLPWLLIPNPTNQWCGNRLSSLQLWFSCNLTKQLMNPLNSNGHKWSLLLISLMVFI 80 
134303126   1 MTMDLFSQFASSTSFGIPLILLAMLVPWLLFPTPSKRWVNNRLLTSQTWFLTVFTKQIFLPLNAPAHKWAFLLTSLMAFL 80 
164519157   1 MILNLFSQFASPNLFGLPLIFIALLAPWFVFPTPCNRWLTNRVVTIQTWFVKTFTKQIFSPLNTPGHKWALILTSLMIFL 80 
55583432    1 LSLNLFSQFASPNLLGLPLIFIALLAPWLMFPTPCNRWLTNRLVTMQTWFINTFTKQIFSPLNTPGHKWALILASLMIFL 80 
14389439    1 MTMDLFSQFASSTSFGIPLILLAMLVPWLLFPTPSKRWVNNRLLTSQTWFLTVFTKQIFLPLNAPAHKWAFLLTSLMAFL 80 
115494669   1 MTMNLFSQFASPTLLGIPLILVAFVVPWLLFPTPCNRWTTNRLVTIQSWFVKTFTKQIFLPLNTPGHKWALILASLMIFL 80 
33438950    1 MMNNLFDQFASPTLFFTPLIIIALLTPWLIFFPATKTCTNNRPNAIQSWFLKTSTKQIFLPINHAGHKWALILASLLVFL 80 
240266597   1 MVTNLFNQFASPTSFGIPLILIAMLIPWMLFPTPSKQWLFNRITSSQSLFLKTFTKQIFLPLNTPGHKWAFILSSLMLFI 80 
260150641   1 MMTNLFDQFASPTMFGIPLILIAMLMPWLLTPAPSKQWISNRLITLQAWFLKTFSKQILLPLNLPGHKWAFIFTSLMIFL 80 
77020088    1 MVTNLFDQFASPTSLGVPLILIAMLVPWLLFPAPSKQWLLNRLTSSQSLFLKTFTKQIFLPLSTPGHKWAFILSSLMLFI 80 
53686495   81 ISMNLLGLLPYTFTPTTQLSMNLGLAAPMWLATVILGLRNQPTMTLGHLLPEGTPTLLIPTLILIETISLFIRPLALGVR 160
134303126  81 LSMNLLGLLPYTFTPTTQLSINLGLAVPLWLATVLLGFRNQFNHSLAHFLPEGTPTPLIPVLILIETISLFIRPLALGVR 160
164519157  81 LGMNLLGLLPYTFTPTTQLSLNLGLAIPLWLATVAIGFRNQLTASLGHFLPEGTPTPLIPILIIIETISLFIRPLALGVR 160
55583432   81 LGMNLLGLLPYTFTPTTQLSLNLGLAIPLWLATVAIGFRNQLTASLGHFLPEGTPTPLIPILIIIETISLFIRPMALGVR 160
14389439   81 LSMNLLGLLPYTFTPTTQLSINLGLAVPLWLATVLLGFRNQFNHSLAHFLPEGTPTPLIPVLILIETISLFIRPLALGVR 160
115494669  81 LGMNLLGLLPYTFTPTTQLSLNLGLAIPLWLATVAIGFRNQLTASLGHFLPEGTPTPLIPILIIIETISLFIRPLALGVR 160
33438950   81 MSINLLGLFPYTFTPTTQLSMNLGLAVPLWLTTVLIGLRNQPTISLGHLLPEGTPTPLIPILIVIETISLFIRPLALGVR 160
240266597  81 LGMNLLGLLPYTFTPTTQLSMNLGLAVPFWLATVLIGLRNQMTASFAHFLPEGTPTPLIPILILIETISLFIRPLALGVR 160
260150641  81 LGMNLLGLMPYTFTPTTQLSMNLGLAVPFWLATVIIGLRNQLAASLAHFLPEGTPTPLIPILIIIETISLFIRPLALGVR 160
77020088   81 LGMNLLGLLPYTFTPTTQLSMNLGLAVPFWLATVLIGLRNQMTASFAHFLPEGTPTLLIPILIVIETISLFIRPLALGVR 160
53686495  161 LTANLTAGHLLIQLISTAIFILLPLMPMVATMTLMMLFLLTLLEIAVAMIQAYVFVLLLSLYLQENI 227
134303126 161 LTANLTAGHLLIHLISSAVSAIFSLSPTASLLTFTVLVLLTILEIAVAMIQAYVFVLLLSLYLQENT 227
164519157 161 LTANLTAGHLLIQLISSATLALLFSSPIVSALTFITLILLTMLEIAVAMIQAYVFVLLLSLYLQENT 227
55583432  161 LTANLTAGHLLIQLISSATLALLFSSPMVSALTFITLILLTMLEIAVAMIQAYVFVLLLSLYLQENT 227
14389439  161 LTANLTAGHLLIHLISSAVSAIFSLSPTASLLTFTVLVLLTILEIAVAMIQAYVFVLLLSLYLQENT 227
115494669 161 LTANLTAGHLLIQLISTATMALLFSNPVVSSLTFATLLLLTMLEIAVAMIQAYVFVLLLSLYLQENT 227
33438950  161 LTANLTAGHLLIHLISSATLAVTAMSTGLTLLTFAVLLLLTILEIAVAMIQAYVFVLLLSLYLQENT 227
240266597 161 LTANLTAGHLLMHLISMTTSVMMSTSIVIAILTFLTLLLLTLLELAVAMIQAYVFVLLLSLYLQENT 227
260150641 161 LTANLTAGHLLIQLISMATSAMLSMSITVASLTFITLILLTLLEVAVAMIQAYVFVLLLSLYLQENT 227
77020088  161 LTANLTAGHLLIHLISTATSVMLSTSIIVATLTFLTLLLLTLLELAVAMIQAYVFVLLLSLYLQENT 227
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap