Conserved Protein Domain Family
ATP8

?
MTH00072: ATP8 
ATP synthase F0 subunit 8; Provisional
Statistics
?
PSSM-Id: 164642
View PSSM: MTH00072
Aligned: 56 rows
Threshold Bit Score: 50.7431
Threshold Setting Gi: 77020087
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62161234   1 MPQLNPGPWFAILIMSWFIYLFILMSKTNNFKYNNDPNMQNvKKIKPQSWNWPWT 55 
55583431   1 MPQLDPMPWFSILFASWLIFLVFSPTKVAKYSSLNDPSPKT-YKGLNKSWPWPWA 54 
162374609  1 MPQLDPAPWFFILLSAWTVFILLSPMKTSNYINLNDPTPKP-YKGLNKPWSWPWP 54 
157939558  1 MPQLDPTPWFFILFSAWMVFILISPMKTSNYIHLNDPTPKP-FKGLNKPWHWPWP 54 
164519156  1 MPQLDPMPWFSILFVSWLIFLAFSPVKVSKYTSLNDPTPKT-YKGLSKSWPWPWS 54 
33438949   1 MPQLLPEPWFYIFFFSWTIFLIATPIKIASYEFFKDPLPGA-LKTNSMTWSWKW- 53 
77020087   1 MPQILERWPIAIFMWSWIIFICLPPKKILTHLFLNEPSSKS-SKISKQTWIWLW- 53 
229324822  1 MPQLLPDPWFTIFIFTWAIFIIAAPMKIASYEFPKDPTPIApKTLPSPAWTWKW- 54 
240266589  1 MPQLLPDPWLTIFMCSWIIFICLAPKKILNHLFLNEPTSKT-SKVLKQTWTWLW- 53 
260150640  1 MPQLLPSPWFLIFILTWFIFISLAPQKILSHLFLNEPTLKF-AKTTKHTWTWLW- 53 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap