Conserved Protein Domain Family
ND2

?
MTH00070: ND2 
NADH dehydrogenase subunit 2; Provisional
Statistics
?
PSSM-Id: 177142
View PSSM: MTH00070
Aligned: 72 rows
Threshold Bit Score: 410.466
Threshold Setting Gi: 5834983
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
134303093   1 MSPLVLSILMSSLALGTMITASSHHWLLAWMGLEINTLAIIPLMAKMHHPRAIEATTKYFITQAAASAVILFSSTTNAWA 80 
55583360    1 MNPYALSIMLSSIATGTIIVVSSSHWLLVWIGLEINTLAIIPLMSQQLHPRSTEATMKYFLTQAIASALILFSATTNAWL 80 
52550941    1 MNPYALSIMLSSLATGTIMVMSGSHWLLVWMGLEINTLAIIPLMNQQLHPRSTEATMKYFLTQAVASALILFSATTNAWL 80 
162374606   1 MNPYALSMIISSLALGTILTLSSYHWILAWVGLEINTLAIIPMMTKTPHPRAIEAATKYFFTQAAASALILFSSTLNAYV 80 
164519153   1 MNPFALYIIISSLALGTITTLSSYHWILAWVGLEINTLAIIPLMTKTPHPRAIEAATKYFLTQAAASALILFASTINAWL 80 
115494664   1 MNPYALSMIVSSLALGTILTLSSYHWILAWVGLEINTLAIIPLMTKTPHPRAIEAATKYFLTQAAASALILFSSILNAFT 80 
52551363    1 MSPYALSIMLSSLAMGTMLVISSSHWLLTWLGLEINTLAIVPLLNQQLHPRSTEATMKYFLTQTLASALILFSATMNAWL 80 
55583428    1 MNPFALYIIFSSLALGTITTLSSYHWILAWIGLEINTLAIIPLMTKTPHPRAIEAATKYFLTQAAASALILFASTINAWL 80 
157939555   1 MNPYALSMIVSSLALGTILTLSSYHWILAWIGLEINTLAIIPLMTKTPHPRAIEAATKYFLTQAAASALILFSSTLNAFT 80 
52551337    1 MGPYAMLVMLTSLAIGTLMTLSSYHWLLAWAGLEISTLAIIPMMTQHPHPRTTEAATKYFLTQATASALILFSSLTNAWS 80 
134303093  81 TGEWDIMNLTsHLSTTTLLMAILMKLGVAPFHFWLPEVMQGIDLTTGLILSSWQKLAPMALLIQVSPNLNPQLLFISGII 160
55583360   81 TNQWQMTELL-PLQTNMITIALAMKLGLAPMHFWLPEVLQGIDLTTGLILSTWQKIAPMMVIYMTYNTLNPHLLTPMAIL 159
52550941   81 TGQWEMKELL-PMQANMTTIALMMKIGLAPMHFWLPEVLQGVDLTTGLILSTWQKIAPMTMIFMIHNTLNPYLLTPMAIM 159
162374606  81 LGEWSINTPPhPASAILLSIAIAMKLGIAPFHFWLPEVLQGSTLQTGLILSTWQKLAPMALLLQLSQSVNLNLMLALGLL 160
164519153  81 TGEWAINTLIsPAPSILLSISLCMKLGIAPFHFWLPEVLQGLTLQTGLILSTWQKIAPMALLIQLSQSVNLNLMLILGLL 160
115494664  81 MGEWAINVPShPIPATLLSIALAMKLGVAPFHFWLPEVLQGSTLQTGFILSTWQKLAPMALLIQLSQSVNLTLMLTLGLL 160
52551363   81 TGQWEIKELL-PMPANMMTIALAMKLGLAPMHFWLPEVLQGINLTTGLILSTWQKIAPMMVIYLIFNSLNQPLLMTMAML 159
55583428   81 TGEWAINSCTsHPTSILPAIALSMKLGIAPFHFWLPEVLQGLTLKTGLILSTWQKIAPMTLLIQLSQSVDLNLMLILGLL 160
157939555  81 VGEWAISVPShPITATLLSIALAMKLGIAPFHFWLPEVLQGSTLQTGFILSTWQKLAPMALLIQLSQSVNLTLMLTLGLL 160
52551337   81 TGQWEIKEMTpPA-SNMLTIALAMKLGLAPMHFWLPEVIQGLDLTTGLILSTWQKIAPMALLYLTSASLNTTLLTILALA 159
134303093 161 STVIGGWGGLNQTQLRKIMAYSSIAHLGWMMTALTISPELTTLNLVIYIIMTTAMFLTLKMFSSTKISTLSSSWQKTPTL 240
55583360  160 STIIGGWGGLNQTQLRKMMAYSSIAHLGWMMAVATMCPNLMLLNFMVYLIMTSSMFLTMKYLKTTSINLLSVSWSSTPTM 239
52550941  160 STIIGGWGGLNQTQLRKIMAYSSIAHLGWMMTMATTCPNLMMLNFMVYLIMTSSMFLTMKYLKTTSINLLYLSWSNTPTM 239
162374606 161 STIVGGWGGINQTQIRKVLAFSSIAHLGWMITILKISPQLTILNFTLYILMTSTLFLTFMSLNTKNMYELSTTWSKTPTL 240
164519153 161 STVVGGWGGINQTQIRKILAFSSIAHLGWMVAILKISPELTLMNFLLYILMTLTLFMTFMSLNTKNIYELSTAWSKSPTL 240
115494664 161 STIVGGWGGINQTQIRKVLAFSSVAHLGWMVAILKISPSLTLLNFSLYILMTSTLFMTFISLNTKNMYELSTTWSKTPTL 240
52551363  160 STIIGGWSGLNQTQLRKIMAYSSIAHLGWMMAISAISPNLMLLNFFIYMIMTTSMFLMMKYLKTTSINMLSLSRFNTP-M 238
55583428  161 STMIGGWGGINQTQIRKVLAFSSIAHLGWMVAILKISPQLTLMNFVIYILMTLTLFMTFIFLNTKNIYELSTAWSKSPTL 240
157939555 161 STIVGGWGGINQTQIRKVLAFSSVAHLGWMVAVLKISPNLTLFNFSLYILMTSTLFLTFISLNTKNMYELSTTWSKTPAL 240
52551337  160 STLLGGWGGLNQTQLRKILAYSSIAHLGWMVIIMPFSPILAMLNFTIYVTLTSTLFLTMKATNTTKINTLTMTWTKTPVL 239
134303093 241 AAMSTLTLLSMGGLPPLTGFMPKWLILQEMTKQNATILATMMALSALLSLFFYIRLTYTMTLTTHPNTTSSTQLWRFStT 320
55583360  240 AAISSLTLLSLGGLPPTSGFMPKWLILQELTKQHTTITATMLAMSSLLSLFFYLRLTYSMTLTNSPNTSNATTTWRQKsN 319
52550941  240 MAISSMTLLSLGGLPPTSGFMPKWLILQELTKHNTVTTATILALSSLLSLFFYLRLTYTMVLTNSPNTSNATITWRRKsN 319
162374606 241 IALSMLSLLSLSGLPPLTGFLPKWLIAQEMIKQNMIMFTLIILLTTLLSLFFYLRFTYSMSLTLAPNLSSSHSLWSFS-- 318
164519153 241 SALSLLSLLSLSGLPPLTGFIPKWLIAQEMVKQDLIMFALVILLSTLLSLFFYLRLTYTMSLTLAPNLSNSTYQWFFS-- 318
115494664 241 AALSMLSLLSLSGLPPLTGFLPKWLIAQEMIKQDMIAFALMILLSTLLSLFFYLRLTYSMSLTLAPNLSSSSLLWF---N 317
52551363  239 TAISSLTLLSLGGLPPTTGFIPKWLILQELTKQQATTIATILAISSLLSLFFYLRLTYTMTMTNSPNLSTSMITWRHNpN 318
55583428  241 SALSLLSLLSLSGLPPLTGFIPKWLIAQEMIKQNLTMFALIILLSTLLSLFFYLRLTYTMSLTLAPNSSNSMYQWSFT-- 318
157939555 241 TALSMLSLLSLSGLPPLTGFLPKWLIAQEMIKQNMIAFTLMILLSTLLSLFFYLRLTYSMSLTLAPNLSSSSLLWF---N 317
52551337  240 ATLSALTLLSLGGLPPMTGFVPKWLILQELTKQNLAPTAMMIAFSALLGLFFYLRLTYTMSLTYSPNNPTTTISWRYKtN 319
134303093 321 QPKLLLMTSATASIALLPSTPLLLSIM 347
55583360  320 QASMPYSLVTIMTILLLPITPNLLPQ- 345
52550941  320 QTSTIYSLMTIMAILLLPITPSMLLL- 345
162374606 319 -PKTTLATPTIFSLLLLPMTPTILAIM 344
164519153 319 -KNNMMATPISLSLLLLPITPTIMILI 344
115494664 318 PSKNILASPMILSLLLLPLTPTIMVII 344
52551363  319 QMSMLYALMTVTAILLLPLMPNILPA- 344
55583428  319 -KNNLLSPSISLSLLLLPVTPTIMALI 344
157939555 318 PSKNILATPMILSLLLLPITPTIMIMI 344
52551337  320 QTTFLLALMMILSMMLLPLTATMKL-- 344
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap