Conserved Protein Domain Family
ND3

?
MTH00069: ND3 
NADH dehydrogenase subunit 3; Provisional
Statistics
?
PSSM-Id: 177141
View PSSM: MTH00069
Aligned: 60 rows
Threshold Bit Score: 155.152
Threshold Setting Gi: 53686328
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
52550947    1 MTMITIYMTTALIIILTLMAFWLPIMNQDTEKLSPYECGFDPLGSARLPFSMRFFLAAILFLLFDLEIALLLPTPWASQL 80 
157939561   1 -MTLFVLLTMVIVSVLASISFWLPTINSDSEKLSPYECGFDPLGSARLPYSMRFFLVAILFLLFDLEIALLLPTPWAAQL 79 
134303094   1 MIYIILLTASAVATLLALISFWLPQISPDTEKLSPYECGFDPLGSARLPFSMRFFLVAILFLLFDLEIALLLPAPWAIQL 80 
55583352    1 MIYTTLLTASAVATLLALISFWLPQISPDTEKLSPYECGFDPLGTARLPFSMRFFLVAILFLLFDLEIALLLPTPWAIQL 80 
58045609    1 MIYIILLTASAVTTLLALVSFWLPQISPDTEKLSPYECGFDPLGSARLPFSMRFFLVAILFLLFDLEIALLLPTPWAIQL 80 
162374612   1 -MPLFVLLTMTIVLVLATVSFWLPTISPDSEKLSPYECGFDPLGSARLPYSMRFFLVAILFLLFDLEIALLLPTPWAAQL 79 
164519159   1 -MIPYVLIALVLSLVLAFISFWLPSLSPDSEKLSPYECGFDPLGSARLPYSMRFFLVAILFLLFDLEIALLLPTPWAAQF 79 
55583434    1 -MTPYVLIAFILSSILALISFWLPSLNPDSEKLSPYECGFDPLGSARLPYSMRFFLVAILFLLFDLEIALLLPTPWAAQF 79 
229324825   1 MLQMFLLVAALLIIILSLISFWLPLIKPDSEKLSPYECGFDPLGSARLPYSMRFFLVAILFLLFDLEIALLLPTPWATQI 80 
33438952    1 MLKTFMFTASILIIILTLISFWIPLIKPDSEKLSPYECGFDPLGSARLPYSMRFFLVAILFLLFDLEIALLLPSPWATQI 80 
52550947   81 NtPSTSVFLAMIILLLLTLGLIYEWLQGGLEWAE 114
157939561  80 PyPTLSILLASVILILLTLGFVYEWLQGGLEWAE 113
134303094  81 EtPMLTIFWSFLILTLRTLGLIYEWLQGGLEWAE 114
55583352   81 NtPMLTIFWSLLILTLLTIGLIYEWLQGGLEWAE 114
58045609   81 DsPMLTIFWSFLILTLLTLGLIYEWLQGGLEWAE 114
162374612  80 PyPTLSIFWSSIILILLTLGFVYEWLQGGLEWAE 113
164519159  80 ShPILVIFWSSVILLLLTLGFIYEWAQGGLEWAE 113
55583434   80 NhPNLVIFWSSIILLLLTLGFIYEWAQGGLEWAE 113
229324825  81 IdPPQMAFWVYTILLLLTLGFVYEWYEGGLEWAE 114
33438952   81 IhPPQMAFFAYFVLLLLTLGFVYEWYQGGLEWAE 114
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap