Conserved Protein Domain Family
ND4L

?
MTH00067: ND4L 
NADH dehydrogenase subunit 4L; Provisional
Statistics
?
PSSM-Id: 177139
View PSSM: MTH00067
Aligned: 63 rows
Threshold Bit Score: 102.374
Threshold Setting Gi: 52551357
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
53686455    1 MSPTLFTFYSTFLLSISGLTLHRTHLLSALLCLEGMMLAMFLAMSMWTKQTEAVSYFSLPMFLLTFSACEASTGLALMIA 80 
162374613   2 IMNESWLLSSTFMLSLFGLSFHRAHLLSALLCLEGMMLSIFIGLSLWALKFTLITPLMYPIVMLTMSACEAGLGLSLMIA 81 
115494672   2 MTNESWLLSSTFMLSLIGLSFHRAHLLSALLCLEGMMLSIFIGLGLWALKFALIAPLMYPIAMLTMSACEAGLGLSLMIA 81 
55583435    3 LTHESWLLASTFFLGLLGLSLHRAHLLSALLCLESMMLSIFVALGLWALKFCLISPMMYPVIMLTLSACEAGVGLALMIA 82 
157939562   2 MTNESWLLSSTFMLSLIGLSFHRAHLLSALLCLEGMMLSIFIGLSLWALKFVLIAPLMYPIAMLTMSACEAGLGLSLMIA 81 
77020091    1 ---MIFLLTMMFTIVLLGLSFHRMHLLSALLCLEGMMLTIFISLSLWPSQLTT-SPLLSPLIMLTFSACEAGLGLSLMIA 76 
33438953    1 -----MLLVLSFAIVLKGLSFHRMHLLSALLCLEGMMLVIFISLGLWPIQFNL-SFVLSPLVMLTMSACEAGLGLSLMIA 74 
229324826   1 -----MLLVLAFAIVLMGLSFHRMHLLSALLCLEGMMLVIFISLGLWPHQFNI-SFVLSPLVMLTMSACEAGLGLSLMIA 74 
240266592   1 ---MIFLMTMMFTIVLLGLSFHRMHLLSALLCLEGMMLTIFIGLSLWPSQLTT-SPLLSPLIMLTFSACEAGLGLSLMIA 76 
260150644   1 ---MTFLLITMFTIVFMGLSFHRTHLLSALLCLEGMMLTIYIALSLWPSQLTP-SSLMFPLIMLTMSACEAGLGLSLMIA 76 
53686455   81 TTRTHNTDHLKALNLLQC 98 
162374613  82 TARSHGSDNLNTLNLLQC 99 
115494672  82 TARTHGSDNLNTLNLLQC 99 
55583435   83 TARTHGTDNLNSLNLLQC 100
157939562  82 TARTHGSDNLNTLNLLQC 99 
77020091   77 TARSNGSDNLKTLNLLRC 94 
33438953   75 TARSHGSDNLKTLNLLRC 92 
229324826  75 TARSHGTDNLKTLNLLRC 92 
240266592  77 TARSYGSDNLKTLNLLQC 94 
260150644  77 TARSHGSDNLKTLNLLQC 94 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap