Conserved Protein Domain Family
ND6

?
MTH00064: ND6 
NADH dehydrogenase subunit 6; Provisional
Statistics
?
PSSM-Id: 177136
View PSSM: MTH00064
Aligned: 31 rows
Threshold Bit Score: 88.3835
Threshold Setting Gi: 190349548
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
123170293   2 SITSGLFSFFVILSCNYNIFVAGGSYCLFLAMLSLISSSILYLTTMSFWYCIIMLLIYVGGVYILLLFVSIYSYNS---- 77 
153126972   1 MLVNFLLFLYIVCSFMFIFSLGSLVRIFLIVVSSLVSSLVLYSIMGFSWYLLLFILVYVGGVYILFVYMSLVLPNVglvn 80 
12249154    1 MITSLFCITYFICMYCFTFSGSSLFRVFLIVVSSFSVGMFIFYCSGSSWYFLLFVLIYFGGVYILFVYISMMLPNSgvss 80 
107735931   3 IISDLLKFLFLLTMVIFTFNSSSLFRSILILVNSLIVSAQIYLEIGFSWYFLLFILVYVGGVYIILIYISMVSPNFslfn 82 
107735986   1 MSLLIVNSLLFLVLVSFTFNSSPLFRSLLILLSSFLISIRIFLELGFSWYFVLFILVYVGGVYIILIYISMAFPNFs--n 78 
12249142    1 MVVTLFCIVYFICLYGFTFCSSSLSRVFLIVISSLSVGVVIFYSTGFSWYFLLFILVYFGGVYILFVYVSMMLPNSgisn 80 
12249157    1 ----MMLVLLSIVLFGFTFNGSPLTRAVLLVLVSFIVSLWIFKVFSFSWYFLLFVLVYVGGIYVILIYVSMAFPNFslfs 76 
153127296   2 SITSGLFSFFVILSCSYNIFVAGGSYCLFLVMLSLISSSILYLTTMSFWYCIIMLLIYVGGVYILLLFVSIYSYNS---- 77 
195952378   3 LIGSCLMSVYLTSLLAFSFVTHPVSYCFLLLLGAFSVSGYVYLITGFTWYLLLFSLVYIGGIYVLFVFVSLHSPNPq--p 80 
224588109   3 LVGGCLMSIYLTSLLAFSFVTHPVGYCFLLLLGAFSVSGYAYLIMGFSWYLLVFCLVYIGGIYVLFVFVSLRSPNPt--p 80 
123170293  78 FSYSNFLSGVIFITFLIAGLlisdspwsaewwCNLTKFSVENDE-SSMLITNSNWVSFIFILIVIIASLIIFSFIFTQNS 156
153126972  81 YRFSYLVGSFLIFLLFFCCM------------WISLCGGEVVVDnSIYLCNSFESFVYLFFCSVLLLGVILINFVVSSFN 148
12249154   81 MSFSYFSFLLVFFFFFFVFF------------FCYEFLGTNVIEySFYLCSDFEAVVYNFFCLILLFGMFIVSLMISSVN 148
107735931  83 MSFVSYYFMFGFTFIIWFCVs-----------RISMIDYSMNIEcSFYLCNSSEILVYIFLCIMLMISLVFVNFIVSLVS 151
107735986  79 FGVNTQYSFTLLAVFFMIYVys--------snYNSVLSQLEFEDcSFYLCNVSEILIYIFLCLVLMIGLVFINFVVSTVG 150
12249142   81 LSFSYISFLLVFFFFFFCFFf-----------LDYSFFGVCLVEySYYLCSDYESVVYVFYCMMLVFGMIMVNLMVSSVS 149
12249157   77 FNLRGWAGFVVLLFLLLGVW------------SDVSVMDEGLMEnSFYLCGVSEVLIYLFLCLVLMISLVFINFIVGFST 144
153127296  78 FSYSNFLSGVIFITFLIAGLlisdspwsaewwCNLTKFSVENDE-SSMLITNSNWVSFIFILIVIIASLIIFSFIFTQNS 156
195952378  81 MLGGGLEFLSAAYFFFLVLFm-----------SAGFKFDSCYFDySHYLCSYFEGFTYCLFCIVLMLGFVLSSVIGSEKD 149
224588109  81 LLGGGLEFLSMAFSFFFVLFv-----------SVGFKLESCYLDySHYLCSYFEGFTYCLFCLILMLGFVLLSVVGSEKD 149
123170293 157 --SYIR 160
153126972 149 --SWLR 152
12249154  149 --EYSR 152
107735931 152 tnSYFR 157
107735986 151 t-SYFR 155
12249142  150 --EYSR 153
12249157  145 s-SYFR 149
153127296 157 --SYTR 160
195952378 150 --SFFR 153
224588109 150 --SFFR 153
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap