Conserved Protein Domain Family
ND4L

?
MTH00061: ND4L 
NADH dehydrogenase subunit 4L; Provisional
Statistics
?
PSSM-Id: 177133
View PSSM: MTH00061
Aligned: 31 rows
Threshold Bit Score: 52.1688
Threshold Setting Gi: 12249146
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12249134   2 LIVMLLCGGGLVLISLLICGHHLFNYLIVLESYNILLLLVCLLMNINDCHIVFISMMALFVLEVSVMLIVVGTNICQGSL 81 
12249146   2 LFVILLLGGGLMLISLVICSHYLFNYLIVLESYNVLLLLICLLVNVQDCQVVFISMMALFVLEASIMLIVVGISICHGSL 81 
12249163   1 MIGIVLLGGGLFILSLLLCQFRLFNYIIIVESFNVIVLLVSLLDSINGCRMIFVTIMSLFVIEISLMLIIVGVEIKEGCL 80 
107735925  1 MISILILGVGLLLIGLFLCNYSLFNYLIILENYNVIVLLISLSILESGCRMMFICMMSMFVVEASLMLMTIGVSIKSGCI 80 
107735982  1 -MWLIILGVGLMLIGLILCNSLLFNYIIVLENFNILILLFALSLNS-GCRMVFICVMSLFVIEVSLMLIVVGNNIKSGCI 78 
123170295  1 MVSLFLFVFTIYCINLLISGFELINLIVFLESLNILFILFSGLKLIGSNPLLWVYFIATATIGVVFILCLLSRLWFCDNF 80 
153126964  1 MLTLVFVCGCFMGLSLILSSVYLFNYLVILENFNVFILIAVLVVSLEESRLLFMSMMALFVLEISLMLIVVGLSLCGDSF 80 
153127290  1 MVSLFLFVFTIYCINLLISGFELINLIVFLESLNILFILFSGLKLIGSNPLLWVYFIATATIGVVFILCLLSRLWFCDNF 80 
195952370  2 PRLLLILGVMIILCSFFLSVSRLLNCLIVVENLNVLLLFITMLSQRGEAYVFFIALMVIFTVEVMLGLVVLTRLWDSSEL 81 
224588101  2 LHLLLVLGVMVILCSFFLSISRLLNCLIVVENFNVLLLFVAMLLQRGESYIFLIALMVIFTVEVMLGLVVLTRLWDSSEL 81 
12249134  82 RISIGF 87 
12249146  82 RVSGGL 87 
12249163  81 RVSIGL 86 
107735925 81 RIPLGL 86 
107735982 79 RVPFGL 84 
123170295 81 FL---- 82 
153126964 81 RLVIGY 86 
153127290 81 FL---- 82 
195952370 82 IDIVGW 87 
224588101 82 IDIVGW 87 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap