Conserved Protein Domain Family
ND3

?
MTH00060: ND3 
NADH dehydrogenase subunit 3; Provisional
Statistics
?
PSSM-Id: 177132
View PSSM: MTH00060
Aligned: 30 rows
Threshold Bit Score: 79.5562
Threshold Setting Gi: 12249165
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12249139    2 YLFFFFFFFVVFFLSLVVCLYNLYVWGykgEDSDVGLdSWISSFECGFMSHGFSENFFSFSYLNLLVFFVIFDLEVSLLL 81 
123170300   1 MAFYLSAILVFLLLILLVHIYHLSWWNn--TLTSIDN-VWVSSFECGFLNFSSAYSSFTYGFIFFLVVFVLFDLEVSLLV 77 
12249151    1 MYMYFFFFFGVLFIVLVVRFYMFYYWGyknLDYKIGRgNWVDSFECGFMTHGFSENFFSFSYLNLLVFFVIFDLEISLLL 80 
107735927   5 SSALLTVIFLVLLPVILTHYNVFGVKSlsgNHYSNIS-EWYSSFECGFLGHGLNENFFSFSYLNLLILFVVFDLEISLLL 83 
8573072     1 MXGLLCGASLGVLLFFLVCAFHSFVWNvsmSSSVGLR-CWVSSFECGFVSQRVTENYFSHTYFVLLVFFVVFDLEVSLLL 79 
153127293   1 MAFYLSAILVFLLLILLVHIYHLSWWNn--TLTSIDN-VWVSSFECGFLNFSSAYSSFTYGFIFFLVVFVLFDLEVSLLV 77 
107735984   5 ILVLCSISLIFIFLIGFSHLFILGSKSfegSRYLSTN-NWYSSFECGFLNHGLNENFFSFSYLNLLIFFIVFDLEISLLL 83 
12249165    5 LLALLIVAFFFTLIIGSITFYVLG-FSfslDHYISLK-EWYSSFECGFLSHGYNENFFSFSYLNLLVLFVVFDLEVSLLL 82 
195952375   1 MRSLLACLVVFMVLFSLISVFHGFFWNsqwGFVSGFR-SWVSGFECGFMSQGVVENYFSYTYFFLLVFFVIFDLEISLLL 79 
224588106   1 MRALLVCFVVFAVLFFLIVGFHIFSWNsgwGFVGGLR-SWVSGFECGFISQGVVENYFSYTYFFLLVFFVIFDLEISLLL 79 
12249139   82 NVAFDGVWFNSFICYLVFILLVIVSYILEVYYGYINWYE 120
123170300  78 NFCFNISSVDNLAFYYLFILGLCLGFTFELLSGSLKWVV 116
12249151   81 NVPFDGVWYNSFFCYMVFMVMILIMYIIEVYYGFVTWTN 119
107735927  84 NIVYDGIWYYTFWCYFFFFFLLFFGYMVELKLGYVSWIN 122
8573072    80 NMPLQGVLYKNLGFYVLFLCLLAVGFGVEIYKGYAEWSY 118
153127293  78 NFCFNISSVDNLAFYYLFILGLCLGFTLELLSGSLKWVV 116
107735984  84 NIVYDGIWLYTFWWNFFFFFFVFLGYMIELNLGYIKWIN 122
12249165   83 NVVFDGIWFYTYWCYFFFFFFVFFCYLIEVGFGYIKWM- 120
195952375  80 NMPFQGLLFKNYPYYVFFLFVLFIGFSVEVNKGYVSWGY 118
224588106  80 NMPFQGLLFKNFPYYLFFLFILAVGFGVEVSQGYVNWGY 118
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap