Conserved Protein Domain Family
ND2

?
MTH00059: ND2 
NADH dehydrogenase subunit 2; Provisional
Statistics
?
PSSM-Id: 177131
View PSSM: MTH00059
Aligned: 32 rows
Threshold Bit Score: 121.19
Threshold Setting Gi: 124056420
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
147742974   3 ARVHSDLVLFSVILSILFCVGCALADSMLGFWVFLELAGLSIIPCFFYSSEFDNLNFYGSLLMYVVMSGLSSVFLMSGVL 82 
12249171    1 -MRGVVIGSFGVLGLLVFSLLVFSVGNLSLFWLFLELSTLSVVPLFFLLGNPWCL---SGLFNYIIASSVSSSLILCGIM 76 
124056420   5 LFNAISTGLVSLCL-----IASLLSSSILILWVLIEISGFCLI-YMFLSCDSNSNVSFSSFLFYL-ANGISSILIVSGAF 77 
107735933   1 ----MTKVYVSILLIALLSLLTLTSGDILMFWLFLEFCSLSMIPCLLQCSNFNVD---DSLLSYIFAISISSSLMLVGLL 73 
12249137    1 ----MFYSVLSIFVLMFLSVLLLFSGDLMTFWLLLELCGLSVIPCFYNNNNVDGLINIDSLLYYLLALGVSSSLILVGII 76 
153127299   5 LFNVISTGLVSLCL-----IASLLSSSILILWVLIEISGFCLI-YMFLSCDSNANVSFSSFLFYL-ANGISSILIVSGAF 77 
12249149    1 ----MLYSFLAITILLSLCVTLVFSGDLLTFWLLLELCSIVVIPCFYWNDNISALSQVDGLLYYLLATSISSSLILVGIL 76 
12249159    1 ----MVKVYVSLLLVSLLCLITLLSGDIMIFWLFFELGSLSLIPCFMYGGSVSVF---DGLLSYIYAISISSSLMLVGVL 73 
107735987   1 ---MDKIIIISIILMTFLGIFSVTSGDILIFWLVLELMSLSLAPCII----NNSFNANDSLMNYIFAISISSSLMLVGLL 73 
190349544   5 LFNLISIIIISLCL-----LTSMMSCSILILWVMIEVSGFCLI-YMFLSCDTNSNISFSSFLFYL-VNGISSILIVSGSF 77 
147742974  83 FLSLYYLILVGFIIKLGLFPFMIWVYFVFAS-SNWFFIFLISVILKFPVLFFSFLLQEKGVceSILYIDCFL-TILLCSS 160
12249171   77 SNSLLFMLLIGLFLKFGLFPFWGWVYGVSLN-SNWLVVWSLSTFLKAPIFFLPFFLAGGSY--FLVNILCCL-SFLVLSV 152
124056420  78 L-ESPTLLEFGLCSKFFIFPFSVILFYIFNN-VSWGVIFIIGTMFKVFILGLSSVIS------LLVNWELLIaTIITCGF 149
107735933  74 YCDFFFFFWLVLWYKFGVFPFIIWIYSVFINsCSWIVCWCISILMKISLLGVSYFIYGYDS--FIFELCVVL-GLFFSGL 150
12249137   77 FPDFFFFFFFGFFLKFGVFPFIFWVYQVFNGsKSWIVCWCVSSILKVSMLYVCYFINNYNS--SIVVGLTGI-GIVFCGL 153
153127299  78 L-ESPTLLEFGLCSKFFIFPFSVILFYIFNN-VSWGVIFIIGTMFKVFILGLSSVIS------LLVNWELLIaTIITCGF 149
12249149   77 FPGIFFFFFFGFFLKFGVFPFIFWVYQVFTSsKSWIICWCISTVLKFPVLYISFFVGQFNI--SLAIFLSSM-GILISGV 153
12249159   74 YSDFFFFFLVGVGVKFCMFPFIGWIYSTFLGaKSWIVCWCISVLMKVVLVSVGCFVCSFYG--WILMLCVFL-GLLFSGL 150
107735987  74 YSDFFFFFFLGFWYKFGVFPCVLWLYSVFCQsKSWLVCWGISVLMKVPLLSVSYFIYGFDS--LILFLCVVF-GLVFSSL 150
190349544  78 L-ESSLLIEFGLCSKFFIFPFSVILFYIFNN-VSWSVIFVIGSMFKVFIVGLGSIVN------IIVGWELIVgTILTCMF 149
147742974 161 LFWLYSLGWEYVWCHISLSSVSTLLVACFCADFILTSFVYAYYSVWAVACLCYFFYLKRMGG----VKE-GFWLFCFLFL 235
12249171  153 LFWFYTYGWLYCWCHMMLSSSAALVAMSFVLSSDVLLLVFFVYCVWSSFVISFLGCCSGSWF----GSVwGYFFFCFLLL 228
124056420 150 FIVFVSLNIKGLWFILNLSSSVVLFVGCVALNNEDVFTLLLIYLVLSLINVSLLSSLDLVNNyyvsVNNsVTLSYLMFIV 229
107735933 151 MFWLYSLSWFSVWAHMVIGSSSVMFYVLNLLGVDKFVFMFILYMIWGSGVLIYFSMFNGFVG------------YLIWLI 218
12249137  154 LIWVYNGNWFILWCHMMLASSNVIFCLSIVSSFLSLLMLYLVYFIWSSGVIYYLGSSSG-----------SLFGYIVWLL 222
153127299 150 FIVFVNLNIKGLWFILNLSSSVVLFVGCVGLNNEDVFTLLLVYLVLSLINVSLLSSLDLVNNyyvsVNNsVTLSYLMFIV 229
12249149  154 LIWVNSINWFAVWCYMMVSSSNVIVCLSVDCSFFNLLIVYLVYFIWSSGVIFYLSSFYG-----------GVFGYVVWLI 222
12249159  151 SFWVNSSNWFIVWCHMTVSSSCLLIYILWLVGVDAFCLILVYYSFWATGVLVYF------------SKSfCMFSYMLWLI 218
107735987 151 MFWLYSLNWFCVWGHIVVSSSCLLFYLISMLDLSEFIFLFLLYIVWSSGVLIYLGLFNG------------FYGYLLFLV 218
190349544 150 FIVFINLNIKGLWFILNLSSSIVLFIGCTLLNNSGIFFLLLTYLMLSLVNVYLLSSLDTINNtyvsTGNsITISYLVFLV 229
147742974 236 ITPLSFPLFYKLSVCLSIVY-SSVYILIVWSLYSLSEQFFLYKLAGDEYLSCTFNVWY 292
12249171  229 SIPVSLSIFYKLVMASGIFS-CWFVVLVSWVIYSVSEQCYLLKFVMSFDLPK--SVFG 283
124056420 230 GFPVSLNLVYKVLSGILVINsSSNLLLLVWTTYIVMETGLLFLYFSN-VLSNLKSLY- 285
107735933 219 SIPFSFSFIYKVIYSYYLAN-LSMYVLLFWFIYCFLEQLYLFKWLASNRVVK--LVWF 273
12249137  223 AIPLSFALYYKIYVSYLLIG-LDLVFLLLWVLYSFLEQFYLFKWIVSSIVPK--SVWY 277
153127299 230 GFPVSLNLVYKVLSGILVINsSSNLLLLVWTTYTVIETGLLFLYFSN-VLSNLKSLY- 285
12249149  223 AIPLSFALYYKIYVSYLLIG-LGWVFVFFWVLYSFLEQFYLFKWLVSSTVPK--SIWW 277
12249159  219 SFPLSFSFWYKVIFSYFMVG-SSVYVLVVWFIYCFLEQLYLIKWVVSTQVVK--SMWC 273
107735987 219 SLPLSFNLIYKVVFSFYLIS-LSFYIMVVWVIYCFMEQLYLFKWLVSNVIVK--SVWI 273
190349544 230 GFPVSFNLIYKILSGILVINiSSSPLLLLWGVYIVLETGLLFLYFSS-IISNLKSIY- 285
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap