Conserved Protein Domain Family
ND1

?
MTH00058: ND1 
NADH dehydrogenase subunit 1; Provisional
Statistics
?
PSSM-Id: 177130
View PSSM: MTH00058
Aligned: 31 rows
Threshold Bit Score: 312.629
Threshold Setting Gi: 107735985
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
153127300   1 MVYLLSESLSFILIMVFVAFFILAERKVLGYIQLRKGPNKTGIAGLMQSFADLAKLVLKAKTYSFQYRSLFSLFGVYLIV 80 
12249138    5 IWSLLVGLEGLLLVLLLVAFFILCERKVLSYIQLRKGPNKVGLAGLLQSFADFMKLVVKIKINGYVVHSWFGWLGCFMLF 84 
162279937   3 IYELVVLIEGLIMILLLVSFYILGERKILSYIQLRKGPNKVGLCGLVQSFADFLKLLSKVNVHGFNFRSWFSVFGCIVMV 82 
12249150    3 IWNFLVWLEGLLVVLFLVAFFILSERKVLGYIQLRKGPNKVGLVGLFQSFADFIKLLSKYKIDGYTVHSWFSWFGCAILL 82 
123170299   1 MVYLLSELLSFILIMVFVAFFILAERKVLGYIQLRKGPNKTGIAGLMQSFADLAKLVLKAKTYSFQYRSLFSLFGVYLIV 80 
162279938   3 MLELVLSIESLIMTLLLVAFYIMSERKVLSYIQLRKGPNKVGIMGLLQSFADFIKLINKSKFNNFSFRSWFSLLGCIVLI 82 
107735985   3 FWGFVISMESLILILILVAFYILGERKILSYIQFRKGPNKVGLVGLLQSFADFIKLLCKSKIIGFSFRSWFSILGCTIMI 82 
190349539   1 MIYLISELLSFILIMIFVAFFILAERKVLGYIQLRKGPNKTGIVGLLQSFADLAKLVLKSKTYSFQYRSLFSLFGVYLIV 80 
195952374   8 VYILFSSFLAFVIIMLFVAFFILGERKILGYMQIRKGPNKVGFLGLFQSFADLLKLVVKFKVSLFQVRSWFGWLGVILLV 87 
224588105   8 VYILFSSFLAFVIIMLFVAFFILGERKILGYMQIRKGPNKVGFLGLFQSFADLLKLIVKFKVSLFQVRSWFGWLGVFLFV 87 
153127300  81 LVSMLYCNIYALFNLEYNSPYLLLMFFLLTSLSSYSILSVGWGSNNKYSLYGSLRSSFGAVSYEMSFMCFLLTIGSVLGF 160
12249138   85 FCSCMGIYIYSCSFSNVYYKFMMLYILIVFTFISYGLLMLGWASWNKYSLLSAVRIAFSSVSYEMIFMCVLLIFGMLLGD 164
162279937  83 VCFLVSVEIYGMFQSGIDSWYALLYFLVVFSFLGYGILLLGWCSWSKYSLISCIRVSFSNVMFEMIFMCILILFGYLYFG 162
12249150   83 ICSSIGVFIYASDCGGLYYKFMMLYILILSTFTGYGLLMLGWGSWNKYSLISAVRVAFASISFEATFMCLVLVLGVIYND 162
123170299  81 LVSMLYCNIYALFNLGYNSPYLLLMFFLLTSLSSYSILSVGWGSNNKYSLYGSLRSSFGAVSYEMSFMCFLLTIGSVLGF 160
162279938  83 SCSVSMVIVYSLVNSNIWCNWILLYFLVVGSIVSYSTLLIGWCSWSKYSLISSIRVSFSSVMFEMILMCIMILFGLMYGG 162
107735985  83 ICSFFMVEIFSFIESNNIGSWSLLYLLIVSSVMGYSLLIIGWCSWSKFSLISSIRVSFSSVMFEMIFMCILILFGILYSN 162
190349539  81 LVSVMYCNIYALYNLEYNSSYLLLMFFLLTSLSSYSILSVGWGSNNKYSLYGSLRSSFGAVSYEMSFMCFLLIIGSVFGF 160
195952374  88 FLACCYCLMFCLSHDGGCDSVLLLWLLLVTSLTGYSVLSVGWGSYNKFALVSCVRSAFGSVTFEACFMCIVVICALVCGS 167
224588105  88 FLSCCYCLVFCLSHDGGCGSVTLLWLLLITSLTGYSVLSVGWGSYNKFALISCVRSAFGSVTFEACFMCIVIICALVCGD 167
153127300 161 YSLYDSYFSySAYsSILLLWPIYLIFILCSLCETNRIPFDFAESESDLVSGFNTEFCNLHFVCLFACEYLIVFIMGWFSS 240
12249138  165 YGNMNICL------MSFITPLNYIVWVVSMFSESNRVPFDYGESESELVSGLNTEYSGIPFMTIYACESVMIYIVSWLTS 238
162279937 163 YGDPGISSV-----LVLIVPIGFLCWLVVLVSENNRTPLDYGECESELVSGVTVEYSSVLFLVIFACEYAMMFIFSWISS 237
12249150  163 YGNLDITY------LIVIAPLNYFAWSVSLLAESNRSPFDYGESESELVSGLNTEYSGLSFIVIFAFEYVMMFISSWITS 236
123170299 161 YSLYDSYFSySVYsSILLLWPIYLIFILCSLCETNRVPFDFAESESDLVSGFNTEFCNLHFVCLFACEYLIVFIMGWFSS 240
162279938 163 YSNPSVSSV-----MLFIAPLAFIAWLIVLLSESNRTPCDYSESESELVSGISVEYSSVLFLVIFACEYLIMFIFSWVSF 237
107735985 163 YKPEMISV------MGIIVPIVLISWLLVLMSEVNRTPFDYAESESELVSGVSVEYSSILFLVIFACEYLIMYIFSWISF 236
190349539 161 YSLYDSYFSyIIYsSIVLLWPIYIIFLICSLCETNRIPFDFAESESDLVSGFNTEFCNLHFVCLFACEXLIXFIMGWFSS 240
195952374 168 YSPFVFLSD-FWG-LFLVLPVCYFLWLVGILCECNRTPLDYAEAESELVSGLSTEYCNVPFTCLFACEYLIMFIFSWLGA 245
224588105 168 YGSFSFLED-FWG-LSFVLPVCYFLWLAGMLCECNRTPLDYAEAESELVSGLSTEYCNVPFTCLFACEYLIMFIFSWLGS 245
153127300 241 IYFFTGTLYYVMLMATIFFFLWSRGTLPRVYYNTFIEFFWAYLLVFLSWFILVIL 295
12249138  239 VIFWGSM--ISLILFHLFLFIWARGTFPRVRYDYYVVLVWKYGLVVSLLYVVCCF 291
162279937 238 FVFWGSS--CIIIVLHLILFIMMRGSFPRVRFDSFVQLVWEYSVIMVVSYLVVLF 290
12249150  237 IVFYGSY--IGLIIFHLFLFIWARGTFPRVRYDYYVAVVWKYGLVVSLIYLLSCY 289
123170299 241 IYFFTGALYYVMLMATIFFFLWSRGTLPRVYYNTFIEFFWAYLLVFLSWFILVTL 295
162279938 238 IVFWSIN--EILIVINLMLFVVMRGSFSRLRFDIFVSVVWNYCVVVILVYLICLF 290
107735985 237 ILFLGFS--KIFIVMSLILFIFMRGSFPRLRFDEFVMLVWEYSVVILLVYLFSFY 289
190349539 241 IYFFNGIAYYIMLMATIFFFLWSRGTLPRIYYNIFIEYFWVYILVFLSWFITIIL 295
195952374 246 VVFFGGGFVVWVGLFHVLFFIWARATLPRIRYDFFVEFMWKYSILLLVCSVFVVV 300
224588105 246 VLFFGGALVIWIGLIHVGFFIWSRATLPRVRYDYFIEFMWKYSILMLICSVFIVL 300
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap