Conserved Protein Domain Family
ND6

?
MTH00057: ND6 
NADH dehydrogenase subunit 6; Provisional
Statistics
?
PSSM-Id: 177129
View PSSM: MTH00057
Aligned: 24 rows
Threshold Bit Score: 171.722
Threshold Setting Gi: 281428836
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
126695328   1 MEGLFYIFALGIIISGIMVISALNPIHSVFWLIVVFLGASALFILLGIDFIALIFLIVYVGAIAILFLFVIMMLNLTDLE 80 
63025141    1 MEALFYLFAFSVIISGIMVISALNPVHSILWLIVAFSSAAVLFIFLEVDFIAFIFLIVYVGAIAILFLFVIMMLNLTDLA 80 
164421042   1 MKELFYAITLAILVSGIMVISALNPIHSVFWLIAVFLGASALFILLNIDFIALIFLIVYVGAIAILFLFVIMMLNLTDLE 80 
164421017   1 MFNIVNVFSMSLIFXGIMVISALNSVHSVLWXIVAFISAXVLFIFLEVDFIALIFLIVYVGAIAILFLFVIMMLNLTDLK 80 
164421194   1 MNLICYLLSVGTMLSAVMVICSKSSVYAVLSLVSAFLNVAGLFVVLGVEFLAFLLLLVYVGAIMVLFLFVLMILMLNEDE 80 
164421164   2 YLFFCYLLSVGIMLSAVMVICSKSSVYAVLSLVSAFLNVAGLFVVLGVEFIAFLLLLVYVGAIMVLFLFVLMILMLNEDE 81 
163854294   1 MFDVVNVFCMFLIISGIMVISALNSVHSVLWLIVSFTSAVVLFIFLEVDFIALIFLIVYVGAIAILFLFVIMMLNLTDLR 80 
164421137   1 METIFYLFAFNVIISGIMVISALNPIYSVFWLIIAFINASVLFILLEVDFIALIFLIVYVGAIAILFLFVIMMLNLIDYE 80 
164421182   1 MEGIFYLFAFNIIISGIMVVSALNPVYSVFWLIIAFINASILFILLDVDFIALIFLIVYVGAIAILFLFVIMMLNLIDYE 80 
170676855   1 MEGLFYLFAFGVILSGIMVISALNPVHSVFWLIVAFTSAALLFILLEVEFIAFIFLIVYVGAIAILFLFVIMMLNLTDLG 80 
126695328  81 GG-GDMSNYIPIGSIIGVLLLFEVlimgreatgynYRDIDHECLRGGVNAWDAsieIIKSSNIEVLGRILYTDYYYLFII 159
63025141   81 DSfQDMSNYVPIGFLIGVIIFFKVli-------fsSGKLSGLSGVINDFRWDF---LEKVSNIEVLGRVLYTDYYYYFLL 150
164421042  81 GV-GDMSNYIPIGSVMGVFLLFEIfiigreaivysNEDTDYTNLTDLLDSWDIsieIIKFSNIEALGRILYTDYFYSFIL 159
164421017  81 GL-LDMSNYMPAGFMIGLVVFFEVli-------ysSWGVSDLSGGRSYFRWDF---IEKVTNIQGLGCILYTDYAYLFIL 149
164421194  81 WQ-GEKSKFVVFVFLFFFFFLFCF----------------------KIGQVTFpnwGVNERGIVLLGRGLYIEYGRGFIA 137
164421164  82 LQ-GEKSKLVVFVFLFVFLFLFCF----------------------KIGQVTFpnwGANERGIVLLGRGLYIEYGEGFIA 138
163854294  81 GL-LDMSNYMPVGFIIGVVVFFEVll-------ffSWGFGDLLEGIDYFRWDF---LEKISNIQVLGELLYTNYAYLFIL 149
164421137  81 KG-RDMSNYLPAGFVIGVIFFITC-------------RIIILSSQLSLFSLNRfdyVENFSNIIGLGRVLYTDYYYLFLI 146
164421182  81 RG-KDMSNYLPAGFVIGVIFFITC-------------RIILLSNQFSTFYVNKfdfIENFSNITGFGRVLYTDYYYLFLI 146
170676855  81 NNpQDMSNYMPTGLIIGVVVILEVl---------iFSSWKSNSEGSPYLRWDY---IEKTSNIEVLGRVLYTDYYYLFIL 148
126695328 160 ASFILLVAMIGAIVLTHELGAEL----KRQDLFTQTSRSLWQ 197
63025141  151 ASFVLLVAMIGAIVLTHDLRVEI----KRQDIFIQISRQLK- 187
164421042 160 ASFILLVAMIGAIVLTHELGIEL----KRQDLFIQTSRNLLQ 197
164421017 150 ASFILLVAMIGVIVLTFSISAEI----KRQEGFIQISR---- 183
164421194 138 GSLILLLAMIGVVELVGDLIWKSnsgvKAEIEKI-------- 171
164421164 139 GSLILLLAMIGVVELVGDLIWESnsgvKRRG----------- 169
163854294 150 ASFILLVAMIGAIVLTFSERSQI----KKQESFIQISRELDE 187
164421137 147 ASLILLVAMIGAIILTHETKKEK----KDQDMFIQISRELWD 184
164421182 147 ASLILLIAMIGAIVLTHEIKKEK----KNQDIFIQISRKFWD 184
170676855 149 ASFILLSAMIGAIVLTQTKSVGI----KRQDSFTQVSRQEVS 186
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap