Conserved Protein Domain Family
ND3

?
MTH00055: ND3 
NADH dehydrogenase subunit 3; Provisional
Statistics
?
PSSM-Id: 177128
View PSSM: MTH00055
Aligned: 20 rows
Threshold Bit Score: 152.171
Threshold Setting Gi: 281428837
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62161303    1 MSVEFLGIFLIILFSITLSTVISGASYVVGVKQPDSEKVSVYECGFDPFGSSRVPFSVKFFLVGILFMIFDLEISFLFPW 80 
63025149    1 MSIEFVNIFLLILFSVTLSTIISGASYIVGNKQPDSEKVSVYECGFDPFGSSRVPFSVKFFLVGILFLIFDLEISFLFPW 80 
126695327   1 MSAEFYGVFIALCLSIVISVAISGASYILGVKQPDIEKVSVYECGFDPFESSRIPFSVRFFLIGILFLIFDXEISFLFPW 80 
164420993   2 INVEFLGVFVLLLISVALSTAISGASYVLGVKKPDSEKVSAYECGFDPFESSRTPFSVRXFLVGILFLIFDLEISYLFPW 81 
164421165   1 --MEMLGAVYLSCCCFGISLLAFVLSYLLVEKVPEQEKSSVYECGFDPYEIARIPFSVRFFLVGILFIIFDLEVVFLFPW 78 
164421043   5 QILEFFVIFIMLCVSIGLSIIISGASYTLGVKQPDSEKVSVYECGFDPFESSRIPFSVRFFLIGILFMIFDLEISFIFPW 84 
164421156   2 INIEFLGIFILLLISVVLSTVISSASYVLGVKKPDSEKVSAYECGFDPFESSRIPFSVRFFXVGILFLIFDLEISYLFXW 81 
163854295   2 INIEYLGI--LILCSLILSTIIFGASYIVGVKQPDIEKVSVYECGFDPFGSSRVPFSVKFFLVGILFLIFDLEISFLFPW 79 
164421018   5 ENMEFWGIFWLILCSIVLSTIISGASYIVGVKQPDIEKVSVYECGFDPFGSSRVPFSVKFFLVGILFLIFDLEISFLFPW 84 
281428837   1 --MEMLGAVYLSCCCFGVSLLAFVLSYLLVEKVPEQEKSSVYECGFDPYEIARIPFSVRXFLVGILFIIFDLEVVFLFPW 78 
62161303   81 CVAYNQIGSFGIWTMYLFLIILTIGLIYEWVKGGLEWE 118
63025149   81 CVVYNQISLFGFWVVYLFLIILTIGLVYEWAKGGLEWE 118
126695327  81 SVVYNQISLFGYWTMIIFLFILTLGLIYEWMKGGLEWE 118
164420993  82 CVVSNQIELLGFWIMVVFXVILTLGLIYEWILGGLDWE 119
164421165  79 GVIYIIIGGLGTWVVYLFLWILVVGLVYEWKVGGLDWE 116
164421043  85 SVVFNQITLFGYWTMIVFLIILTLGLIYEWVKGGLEWE 122
164421156  82 CVVSNQIELLGFWIMIIFLIILTLGLIYEWIXGGLDWE 119
163854295  80 CVVLNQIKLFGVWVMYLFLIILTLGLIYEWVRGGLEWE 117
164421018  85 CVVLNQINILGVWVMYLFLIILTIGLIYEWVRGGLEWE 122
281428837  79 GVIYIIMGGLGTWVVYLFLWILVVGLVYEWKVGGLDWE 116
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap