Conserved Protein Domain Family
ND1

?
MTH00054: ND1 
NADH dehydrogenase subunit 1; Provisional
Statistics
?
PSSM-Id: 177127
View PSSM: MTH00054
Aligned: 22 rows
Threshold Bit Score: 422.599
Threshold Setting Gi: 164421191
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
63025152    1 MGIIIIKVLIILVSLLISIAYLTLAERKVLGYIQCRKGPNVVGLYGLLQPIADGLKLFTKEIIIPNHANFFIYILAPILS 80 
164421145   1 MGMIIIKILVILVPLLISIAYLTLAERKVLGYIQSRRGPNVVGAYGLLQPLADGLKLFTKEIIIPNHANIYIYIMAPILS 80 
164421044   1 MVGIIIKILAIIVPLLISIAYFTLAERKVLGYIQCRKGPNMVGVYGLLQPLADGVKLFTKEMVVPNHANIFIYFMAPIFS 80 
164421021   1 MIGVLMKVLCILVPLLVSIAYLTLAERKVLGYIQGRKGPNVVGVYGVLQPIADGLKLFTKEIIIPNHANMYIYILSPIFS 80 
164421161   1 --MWWCKAISVILPVLIAVAFITLAERKLLGIIQRRRGPNIVGSGGFLQAFADGLKLFSEEIFLPSQINLGLYFFVAVFA 78 
164421191   1 --MWWCKAISVILPVLIAVAFITLAERKLLGILQRRRGPNIVGSGGFLQAFADGLKLFSEEIFLPSQINLGLYFFVAVFA 78 
170676859   1 MGIIIIKILTILVPLLISIAYLTLAERKVLGYIQCRKGPNVVGVYGLLQPIADGLKLFTKEIIIPNHANLFIYILAPVLS 80 
164420982   1 MEVVVIKTLVILVPLLISIAYLTLAERKVLGYIQSRRXPNVVGVYGLLQPFADGLKLFTKEVIIPNHANIFIYIMAPILS 80 
163854298   1 MYGYLGKIFCIIVCLLISIAYLTLAERKVLGYIHSRKGPNVVGIYGVLQPIADGLKLFTKEMIIPNHANMYIYILAPIFS 80 
126695334   1 MLAIIIKTLAIIVPLLISIAYLTLAERKVLGYMQCRKGPNVVGVYGLLQPIADGVKLFTKEMIIPNHANIFIYIMAPILS 80 
63025152   81 LTLAFIAWGVIPYNQGVVLSDLEVGILYLFAVSSISVYAILMSGWSSNSKYAFLGAIRAAAQMISYEVSIGLIIISVVLC 160
164421145  81 LTLAFIAWGVIPYGEGFVLSDLSIGILYLFAVSSISVYAVLMSGWASNSKYAFLGAIRAAAQMISYEVSIGLIIISVVLC 160
164421044  81 LMLAFIAWAVIPYGQGIVLSDLNVGILYLFAVSSISVYAILMSGWASNSKYAFLGAIRAAAQMISYEVSIGLIIISVVLC 160
164421021  81 LTLAFIVWGAVPYGEGRVLSDIGIGILYLFAVSSISVYAILMSGWSSNSKYAFLGAIRGAAQMISYEVSIGLIIISVVLC 160
164421161  79 LGVAFLPWGVIPYGN--LFMDLHLGILYLFFVSSISVYAVLMSGWVSNSKYAFDGAVRGTAQMVSYEVSIGLLFLSVCLC 156
164421191  79 LGVAFLPWGVIPYGN--LFMDLHLGILYLFFVSSISVYAVLMSGWVSNSKYAFDGAVRGTAQMVSYEVSIGLLFLSVCLC 156
170676859  81 LTLALIAWGVIPYSEGVVLSDLGVGLLYLFAVSSISVYAILMSGWGSNSKYAFLGAIRAAAQMISYEVSIGLIIISVVLC 160
164420982  81 LTLAFIAWGVIPYGEGFVLSDLSIGILYLFAVSSISVYAVLMSGWASNSKYAFLGAIRAAAQMISYEVSIGLIIISVVLC 160
163854298  81 LTLALIAWGVVPYGEGVMLSDMGLGILYLFAVSSISVYAVLMSGWSSNSKYAFLGAIRGAAQMISYEVSIGLIIISVVLC 160
126695334  81 LVLAFIAWAVIPFTQNVVLSDLNIGILYLFAVSSISVYSILMSGWASNSKYAFLGAIRAAAQMVSYEVSIGLIIISVVLC 160
63025152  161 VGTLNLIEIVITQKNIWFIVPLFPAGIMFFVSALAETNRVPFDLTEGESELVSGFNVEYSSMSFALFFLAEYCHIILMSA 240
164421145 161 VGSLNLIEIVLAQKNIWFIVPLFPAAIMFFVSALAETNRVPFDLTEGESELVSGFNVEYSSMSFALFFLAEYAHIILMST 240
164421044 161 VGSLNVTDIVMAQSWVWFGLPMYPAAIMFFVSALAETNRVPFDLTEGESELVSGFNVEYSSMSFALFFLAEYGHIILMSA 240
164421021 161 VGSLNLMGIVLSQKKIWYIIPLFPAAIMYFVSALAETNRVPFDLTEGESELVSGFNVEYSSMSFALFFLAEYCHIILMSV 240
164421161 157 CRSLSLPEIVKVQEGVWLAFPLFPIMVMFFVSALAETNRVPFDLTEGESELVSGFNVEYRSFLFAMFFLAEYIHILLMSV 236
164421191 157 CRSLSLLEVVKVQEGVWLAFPLFPIMVMFFVSALAETNRVPFDLTEGESELVSGFNVEYRSFLFAXFFLAEYIHILLMSV 236
170676859 161 VGSLNLTQIVLTQTTVWFILPLFPIALMFFVSALAETNRVPFDLTEGESELVSGFNVEYSSMSFALFFLAEYCHIILMST 240
164420982 161 VGSLNLTEIVLAQKNIWFVIPLFPAAIMFFVSALAETNRVPFDLTEGESELVSGFNVEYSSMSFALFFLAEYAHIILMST 240
163854298 161 VGSLNLTEIVLSQRKIWYILPLFPAVIMFFVSALAETNRVPFDLTEGESELVSGFNVEYSSMSFALFFLAEYCHIILMSA 240
126695334 161 AGSLNITDIVTAQSKIWFIFPLFPAAIMFIVSALAETNRAPFDLTEGESELVSGYNVEYSSMSFALFFLAEYGHIILMSA 240
63025152  241 FGVILFLGGWLsplkeisyewggewTYSVLSENLSNYWWFGIKVAIIIFLFIWIRASYPRIRYDQLMALLWKSYLPLSLA 320
164421145 241 FGVILFLGGWF-----------------LPGGLMSNSLLMGGKVAFIIFLFIWIRASLPRIRYDQLMALLWKTYLPLSLA 303
164421044 241 MITIFFLGGWK--------------VPIIELLWKGNVLFFGIKTILIVFVFIWIRGSLPRVRYDQLMILLWKSYLPLSLG 306
164421021 241 LGVILFLGGWQ-----------------APLNMFEGNVMFGIKIAFLLFLFIWIRGTYPRIRYDQLMSLLWKSYLPLSLG 303
164421161 237 LGSVLFLGGSF----------------------------LFVKGGLLVFWFIWVRGTLPRVRYDQLMELLWKSYLPLSLG 288
164421191 237 LGSVLFLGGSF----------------------------LFVKGGLLVFWFIWVRGTLPRVRYDQLMELLWKSYLPLSLG 288
170676859 241 FGVILFFGGWLgpfe-------gyfEYSIFDANWTHYWWLGGKVAFLIFLFIWIRGTYPRIRYDQLMALLWKSYLPLSLA 313
164420982 241 FGVILFLGGWV-----------------FPGGLISSSLFMGVKVAFIIFLFIWIRASLPRIRYDQLMALLWKSYLPLSLA 303
163854298 241 LGVILFLGGWW-----------------VPLKGFESNGVFGIKIGFLLFLFIWIRGTYPRIRYDQLMYLLWKSYLPLSLG 303
126695334 241 FTTILFLGGWK--------------APMIEPIFKGSVIWFAIKTALIIFLFIWVRASFPRIRYDQLMALLWKSYLPLSLG 306
63025152  321 FVVLVGGILIGFNVLPPI 338
164421145 304 YVVFVLSILIGFNGLPPA 321
164421044 307 FVVFVSSILIGFNGLSPP 324
164421021 304 FVGLVSGVLVGFNGLAGF 321
164421161 289 GLGLVSGILIGAQ----- 301
164421191 289 GLGLVSGILIGVQ----- 301
170676859 314 FVVLVSGLLIGFDILPPF 331
164420982 304 YVVFVLSILIGFNGLPPA 321
163854298 304 FVGLVSGALVGFNALPAF 321
126695334 307 LVVLVSSILIGFNGLPPL 324
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap