Conserved Protein Domain Family
CYTB

?
MTH00053: CYTB 
cytochrome b; Provisional
Statistics
?
PSSM-Id: 164624
View PSSM: MTH00053
Aligned: 18 rows
Threshold Bit Score: 584.747
Threshold Setting Gi: 281428834
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62161299    1 MTKTIRKENPVISLINSFLIDLPSPSNISYLWNFGVLLGICLVIQIITGIFLAMHYCSDVNLAFTSVAHITRDVNYGFIL 80 
163854291   1 MFKSFRKENPVVSIVNNLFIDLPAPSNINYLWNFGSLLGFSLIIQVITGIFLAMHYCPDIDLAFTSVAHITRDVNSGFVL 80 
164420975   1 MTKSFRKENPVLSLVNGMFVDLPSPSNISYLWNFGSLLGICLIIQIITGIFLAMHYCADIDLAFKSVAHITRDVNYGFLL 80 
164420989   1 MTKAFRKDNPIVSIVNSIFIDLPAPSNISYLWNYGSLLGICLGVQIVTGIFLAMHYCADVDLAFSSVAHITRDVNYGFVL 80 
164420960   1 MTKSFRKENPVLSLVNGMFIDLPSPSNISYLWNFGSLLGFCLATQIVTGIFLAMHYCADVNLAFSSVDYITRDVNYGLVF 80 
164421192   1 MNGSIRKES-IFQFVNSLVVDLVTPINLSYLWNWGSLLGFFLVGQIVTGVFLAMFYCPHETLGFRLLVELGLNINSGFFX 79 
164421162   1 MSGSIRKES-VFQFVNSLVVDLVTPANISYLWNWGSLLGFFLVGQIITGIFLAMFYCPQETLGFRLVAELGLNINSGFFF 79 
164421152   1 MTKAFRKENPIFSLVNSIFIDLPAPSNISYLWNYGSLLGLCLVVQIITGIFLAMHYCSDVDLAFSSVAHITRDVNYGFII 80 
164421134   1 MNRAIRKENPVLSLINEIFVDLPSPSNISYLWNFGSLLGISLIIQIVTGIFLAMHYCPDVNLAFSSVAHITRDINYGFIL 80 
164421179   1 MNKTIRKENPVISLINNMFIDLPSPSNISYLWNFGSLLGISLIIQIITGIFLAMHYCPDINLAFSSVAHITRDVNYGFIL 80 
62161299   81 RYLHANGASMFFLCVYLHIGRGIYYGGYNKLIVWNVGVLLFFLMILTAFIGYVLPWGQXSFWAATVITNLLSAIPYVGDE 160
163854291  81 RYLHANGASMFFLCVYFHIGRGVYYGSYTKVIVWNVGVIIFLVMILTSFIGYVLPWGQMSFWAATVITNILSAIPYVGED 160
164420975  81 RYLHANGASMFFLCVYIHIGRGMYYGSYTKQIVWNVGVLLYILMMGTAFIGYVLPWGQMSFWAATVITNFLSAIPYIGDD 160
164420989  81 RSLHANGAAMFFLCVYLHIGRGIYYGSYNKMIVWNVGIVIYLLMMLTAFIGYVLPWGQMSFWAATVITNLVSAVPYIGDD 160
164420960  81 RYLHANGAHMFFLCVYIHIGRGIYYGSYTKQIVWNVGVLLYILMMGTAFMGYVLPWGQMSFWAASVITGLLSAIPYIGED 160
164421192  80 RYLHANGASVFFLCVYFHIAKGLYYGGYLKRKVWWTGIVIYIVMIATAFLGYVLPWGQMSFWAGAVIPDLFSVVPYVGEE 159
164421162  80 RYLHANGASVFFLCVYFHIAKGLYYGGYLKRKVWWTGIVIYLVMVATAFLGYVLPWGQMSFWAGAVITNLFSVVPYVGEE 159
164421152  81 RSLHANGASMFFLCVYLHIGRGIYYGSYNKMIVWNVGIIIFLLMMLTAFIGYVLPWGQMSFWAATVITNLVSAIPYIGDD 160
164421134  81 RYLHANGASMFFLCVYFHIGRGIYYGSYLKIIVWNVGVLIFLLMIVTAFIGYVLPWGQMSFWAATVITNLLSAIPYVGDD 160
164421179  81 RYLHANGASMFFLCVFFHIGRGIYYGSYLKHIVWNVGVLIFLLMIVTAFIGYVLPWGQMSFWAATVITNLLSAIPYVGDD 160
62161299  161 IVRWVWGGFSVSNATLNRFFSLHYLLPFVLVGLALVHLIAKHEEGTNNPLGIRSDIDMIPFHYYFALKDLYGAVVLAIVL 240
163854291 161 IVRWIWGGFSVSNATLNRFFSLHYLLPFVLVALAIVHLIALHEDGSNNPIGITSDFDKIPFHYYYLLKDLYGIVIFSLVL 240
164420975 161 VVRWVWGGFSVSNATLNRFYSLHYLLPFILAGLALVHLIALHEDGSSNPIGVRSDIDKIPFHYYYVLKDLYGIVVLAIIL 240
164420989 161 VVKWIWGGFSVSNATLNRFFSLHYLLPFVLAALAVVHLLALHEGGSNNPIGVRSDIDKIPFHSYYVFKDMYGAIVLGFIA 240
164420960 161 VVRWVLGGFGVSNATLNRFYSLHYLLPFILAGLSLVHLIALHEGGSNNPIGVRSDIDKIPFHNYYAFKDLYGVVVLAMVL 240
164421192 160 IVHWVWGRFSVSNATLNSFYSLHYLLPFILVGLMGVHLFFLHEGGSNNPLGVGSGADSVTFYPHFIIKDVSGNLIILFIT 239
164421162 160 IVHWVWGGLSVSNATLNSFYSLHYLLPFILVGLMGVHXFFLHEGGSNNPLGVWSEADSITFYPHFIIKDISGNLIILFIT 239
164421152 161 LVKWIWGGFSVSNATLNRFFSLHYLLPFVLAALAIVHLLALHEDGSNNPIGVRSDIDKIPFHSYYVFKDMYGLVVLAMIT 240
164421134 161 IVKWVWGGFSVSNATLNRFYSLHYLLPFLLAGLSLIHLIALHEDGSNNPVGVKSDIDKISFHYYYVLKDLYGLIIFSILL 240
164421179 161 IVKWVWGGFSVSNATLNRFYSLHYLLPFVLAGLSLIHLIALHEDGSNNPVGIKSEVDKIPFHYYFVLKDLYGLIVFLIIL 240
62161299  241 SIIVFLFPYSLSDPENFKQANPLVTPVHIKPEWYFLFAYAILRSIPNKLGGVVALVFSILILLILPYVHINKFEGLSFRP 320
163854291 241 CIIVFFFPYILGDAENFKQANPLVTPVHIKPEWYFLFVYAILRSIPNKLGGVVALVFSILVLLFLPYLHKNRFKGVRFRP 320
164420975 241 SVFVFLFPYTLGDPENFRQANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVVALVASLLVLFFLPLLHKSRLRGLTFRP 320
164420989 241 LVLVFLFPYVLGDPENFQPANPLVTPEHIKPEWYFLFAYAILRSIPNKLGGVVALVSSILVLFLLPYLHQSRFRGLPFRP 320
164420960 241 SVFVFSPPYLLGDPENFRQANPLVTPTHIQPEWYFLFAYAILRSIPSKLWGVVALVSSLLVLFLIPLLHKSQLRGLTFRP 320
164421192 240 GIVLFFYPYWFGDAENFKCADPLVTPPHIKPEWYFLFIYAILRSIPNKIGGVLALAGSLLVWXILPFIFYGRLRGASFRP 319
164421162 240 GIILFFYPYWLGDAENFKCADPLVAPVHIKPEWYFLFIYAILRSIPNKIGGVLALAGSLLVWFILPFIFYGRLRGASFRP 319
164421152 241 LMIVFLFPYVLSDPENFQPANPLVTPEHIKPEWYFLFAYAILRSIPNKLGGVVALVSSILILFLLPYLHQSRFKGLTFRP 320
164421134 241 IVLVFLFPYLLSDPENFKQANPLVTPVHIKPEWYFLFAYAILRSIPNKLGGVLALIFSILVLFLLPYLHLSKLRGLRFRP 320
164421179 241 IILVFLFPYSLSDPENFKQANPLVTPVHIKPEWYFLFAYAILRSIPNKLGGVLALICSILVLILLPYLHLSQFRGLRFRP 320
62161299  321 LSKILFWFLVGDFILLTWIGGQPVEDPYILIGQFAAIFYFAYFLILTPIVARVENKLLRLT 381
163854291 321 LSKVLFWFLVGDFLLLTWIGGQPVEDPYILIGQIVSVFYLAYFLILTPLIGHLENKLLKLV 381
164420975 321 LSKILFWFLVADFLLLTWIGGQPVEDPYILIGQIASIFYFSYFLILSPLIGYLENKLLKLS 381
164420989 321 LSKILFWFLIADFLLLTWIGGQPVEEPYILVGQIASIGYFAYFLLLTPLVGYLENKLLQLY 381
164420960 321 LSKMLFWFLVADFLLLTWIGGNPGESPYIFIGGMASIFYFSYFLILSPLAGYLENKFLGLV 381
164421192 320 IGKLFFWCLIFDFVLLTIIGGKPVEVPYISVGQFASVFYFFYFLVLMPWAGWLENRLLIDR 380
164421162 320 IGKLFFWCLIFDFFLLTIIGGRPVEVPYISVGQFAAVFYFFYFLVLMPWAGWLENRLLSVK 380
164421152 321 LSKILFWFLIADFFLLTWIGGQPVEEPYILVGQIASIGYFVYFLLLTPVVGYLENKLLQLY 381
164421134 321 ISKLLFWFLVGDFLLLTWIGGQPVEEPYILIGQLASIFYFVYFLILIPLISYAENKLLKLI 381
164421179 321 FSKIFFWFLVGDFLLLTWIGGQPVEEPYILIGQLASIFYFVYFLILIPLISYVENKLLKLI 381
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap