Conserved Protein Domain Family
COX3

?
MTH00052: COX3 
cytochrome c oxidase subunit III; Provisional
Statistics
?
PSSM-Id: 164623
View PSSM: MTH00052
Aligned: 20 rows
Threshold Bit Score: 394.93
Threshold Setting Gi: 164421200
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
63025101    1 MMQQVYHPYHLVKPSPWPYIGGCGALLTTVGAIVYFHYSPAWVLSFGLVIIVVTMVVWWRDVIREATYQGHHTLIVKQGL 80 
164421055   1 -MSHQYHPYHLVDPSPWPYIGACAALFTTVGSVMYFHYNQSWILKLGLITLLLIMIVWWRDVIRESTFQGHHTQIVKQGL 79 
164421146   1 -MQHYYHPYHLVDPSPWPYIGSCGAFFTTVGAVMYFHYSQSWILILGLITIVFTMVVWWRDVIRESTFQGHHTFIVKQGL 79 
164421170   1 --MKYYRPYHLVDSSPWPFLGGCAGLSLVVGGILYMHYGYIWLMVSGVLFVGIIMVVWWRDVVRESTFLGKHNTIVKRGI 78 
164420983   1 -MQHYYHPYHLVDPSPWPYIGSCGAFFTTVGAVMYFHYSQSWILILGLITLIFTMVVWWRDVIRESTFQGHHTFIVKQGL 79 
126695331   1 -MSHQYHPYHLVDPSPWPYIGGCSALFTTIGAVMYFHYNQAWVALLGLTALGFTMIVWWRDVIRESTFQGHHTLIVKQGL 79 
164421178   1 MMQQVYHPYHLVDPSPWPYIGGCGAFFTTVGGVMYFHYSQSWILIFGLIIVIFTMFVWWRDVIRESTFLGHHTLIVKQGL 80 
164421133   1 MMQQVYHPYHLVEPSPWPYIGGCGALFTTVGAVMYFHYSQSWVLILGFIIVIFTMIVWWRDVIRESTYQGHHTLIVKQGL 80 
164421117   1 MMQQIYHPYHLVKPSPWPYIGGCGALLTTVGAVVYFXYSPSWVLSLGLITIAVTMVVWWRDVIREATYQGHHTLVVKQGL 80 
281428842   1 --MKYYRPYHLVDSSPWPFLGGCSGLSLVVGGILYMHYGQIWLVMSGILXVGIIMVVWWRDVVRESTFLGKHNTVVKRGI 78 
63025101   81 KYGMILFILSEVCLFFSFFWAFFHSSLVPTVEIGAVWPPRGVDPLNPFSVPLLNTVVLLSSGATVTWTHHAIISGKRKEA 160
164421055  80 KYGMILFIISEVCFFFSFFWAFFHSSLAPAIEIGAVWPPRGIDVLNPFSVPLLNTAVLLSSGATVTWAHNAIISGKRKEG 159
164421146  80 KYGMILFILSEVCLFFSLFWAFFHSSLAPAIEVGAIWPPRGVNPLNPWSVPLLNTAVLLSSGATVTWAHHAIISGKRKEX 159
164421170  79 KYGMILFIVSEIMLFFSLFWAFFHNSLSFAVELGGCWVPRGVEALDYKAVPLLNTALLLGSGMLVTWAHYGIIRGWRVVG 158
164420983  80 KYGMILFILSEVCLFFSLFWAFFHSSLAPTIEVGAVWPPRGVNPLNPWSVPLLNTAVLLSSGATVTWAHHAIISGNRKDA 159
126695331  80 KYGMILFIVSEVCFFFSFFWAFFHSSLAPAIEIGAVWPPKGIDVLNPFSVPLLNTAVLLSSGATVTWAHHGIISGKRKEA 159
164421178  81 KFGMILFIISEVCLFFSFFWAFFHSSLAPTIEIGAVWPPRAIEPLNPFSVPLLNTAVLLSSGATVTWAHHGIISGKRKEA 160
164421133  81 KYGMILFIISEVCLFFSFFWAFFHSSLAPTIEIGAIWPPRAIEPLNPFSVPLLNTAVLLSSGATVTWAHHGIISGKRKEA 160
164421117  81 KYGMLLFILSEVCLFFSFFWAFFHSSLVPTIEIGAVWPPRGVDPLNPFSIPLLNTVVLLSSGATVTWTHHAIISGKRKEA 160
281428842  79 KYGMILFIVSEVMLFFSLFWAFFHNSLSFAVELGGCWVPRGVEALDYKAVPLLNTALLLGSGMLVTWAHYGIIRGWRVVG 158
63025101  161 IIGLVFTVFLGILFTGLQAMEYYEAPFTISDSVYGSTFFLTTGAHGAHVLIGSSFLLVCLIRLIYYQFTRHHHFGFEAAV 240
164421055 160 IQGLTLTIILGILFTSLQAMEYYEAPFAISDSVYGSTFFVATGFHGLHVLIGTTFLIICLGRLIVYQFTQHHHFGFEASA 239
164421146 160 ILGLFITVLLGIGFTGLQAMEYYEAPFTISDSVYGSTFFVTTGAHGGHVLIGSTFLLVCLFRLISHQFTRHHHFGFEAAA 239
164421170 159 LRALGSGVALGLLFTCLQGFEYYVASFTIADSVYGSVFYLMTGAHGLHVIIGSVFLTVCWFRLLYYQFRDDDPVGFELAA 238
164420983 160 IAGLFLTVLLGIGFTGLQAMEYYEAPFTISDSVYGSTFFLTTGAHGGHVLIGSTFLLVCLFRLISHQFTRHHHFGFEAAA 239
126695331 160 IIGLTLTVLLGILFTSLQAMEYYEAPFAISDSVYGSTFFVATGFHGLHVIIGTTFLIVCLIRLIAYQLTQHHHFGFEASA 239
164421178 161 IIGLTLTVVLGLLFTALQAMEYYEAPFTISDSVYGSTFFVTTGFHGAHVLIGSSFLIVCLFRLINHQFTRHHHFGFEAAA 240
164421133 161 IIGLTLTVILGLLFTALQAMEYYEAPFTISDSVYGSTFFVTTGLHGAHVLIGSTFLIVCLFRLVNHQFTRHHHFGFEAAA 240
164421117 161 IIGLILTXILGVLFTGLQAMEYYAAPFTISDSVYGSTFFLTTGAHGAHVLIGSSFLLVCLLRLIYHQFTRHHHLGFEAAV 240
281428842 159 LRALGSGVALGLLFTCLQGFEYYVASFTIADSVYGSVFYLMTGAHGLHVIIGSVFLTVCWFRLLYYQFRDDDPVGFELAA 238
63025101  241 WYWHFVDVVWLFLFIFMYWWGS 262
164421055 240 WYWHFVDVVWLFLYVCIYWWGS 261
164421146 240 WYWHFVDVVWLFLFIFMYWWGS 261
164421170 239 WYWHFVDVVWLFLYIFVYCWGS 260
164420983 240 WYWHFVDVVWLFLFIFMYWWGS 261
126695331 240 WYWHFVDVVWLFLYVCIYWWGS 261
164421178 241 WYWHFVDVVWLFLFTFMYWWGS 262
164421133 241 WYWHFVDVVWLFLFTFMYWWGS 262
164421117 241 WYWHFVDVVWLFLFVFMYWWGS 262
281428842 239 WYWHFVDVVWLFLYIFVYCWGS 260
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap