Conserved Protein Domain Family
ATP6

?
MTH00050: ATP6 
ATP synthase F0 subunit 6; Validated
Statistics
?
PSSM-Id: 177125
View PSSM: MTH00050
Aligned: 32 rows
Threshold Bit Score: 152.731
Threshold Setting Gi: 190349540
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
12249170    1 MFVSRLGVLYNLVVGFVLGGWSDYLYRMCLFFLLCCFLYLRMPYLYGLLGFGLFLIFSVIPLFLALFLGRLLDvGLFSFF 80 
12249158    3 IGLWYNKLVEWISLRLVKVMISEWWYSFVMISVFCGLVMTRCPYIYGWIGFFAFLVCCVLPLFISLIVTRLNV-SAVEFF 81 
107735989   3 SGLWLSSIVKWICVNIIKTAKVEWWYGFIVLIIMLGFILTRCPYIFSILGFVSFLFVLIIPLYMSLVLSRIDD-SIMNFF 81 
8573071     1 MRMTRFESVKSFLEGLMVGGGGDAVYRVVLCALLFCFLSLRFPYLFDLVSFAPFLVFAILPLFLSLFLSRLLDgSLVAFF 80 
12249136    2 LSGLWVTSFLVRLSKWLKVLSFEKWYSLSLFILIVLFALVRCPYIYHMFSFSLIIIALIVPLYLSLFFSRMFT-TFSLFI 80 
12249148    2 LSGLWFTSFLVKLSSYLKVMKIEMWYSLSLFILIFVFAIVRFPYVYGMFDYGLCLIVLIMPLFISLFFSRLFC-AFGLFV 80 
107735932   3 VGLWTNSMINWFSLNIIGGINSEKWYSFIILIVFSELLFTRCPYIYNYTWFILLLFTSIIPLYISLVLTRLYV-SLYKFF 81 
190349540   2 IFNSSVNYILTNIKLIINNN---VLSSSLLFIVLCEFMLYRIPGIFDVHYFIVFLFIALLPYFISLFTSRVTN-DWEEFF 77 
195952372   1 MFVSRLSAAFDCFSFVFSGGLNSFLCRLSLFVLFWGFLSLRLPYVYGMGGFVLFIFFIVCPLFSSLFLSRVLGgGLSGFF 80 
224588103   1 MFVSRLFGVFDYFSLIIRGGLCSPFYRLSLFLLLGGFLSLRLPYVYGMGGFVLFIFFIVCPLFCGLFFSRVLDgGLSCFV 80 
12249170   81 SGFVPSGTPLWIAPFVCLAETLSYVVRPIVLIIRPFVNLTIGSFGGVAIGALGFkYGFGVFVFLVV-LFFYEVFVALVHW 159
12249158   82 GSMIPEGSPIWILPFIQYVEIISYIIRPFVTVIRPFVNVSVGIRLGVSVGWLCIgSSFYIYFFMVF-LFIYEILVVFIHW 160
107735989  82 ASFIPDGSPMWILPFIPHIEILSYVIRPVVLLLRPFINISVGTYLGIMIGSLCFsFSGYLLIVLIF-LFIYEVFIVFVHW 160
8573071    81 SAFVPSGTPVWIAPFVCMAETLSYLVRPVVLVIRPFVNLSMGAMGGYVLGLLVF--RFSWAIFLFF-LFFYEVFVAVVHW 157
12249136   81 SGFIPIGSPILLSPFVCIIELVSYIIRPIVLLIRPFVNISAGVYFGIGLGSISFlLDYYYISLLFIiLFVYEIFVALMHW 160
12249148   81 SSFIPVGCPIYLAPFVCIIELISFIIRPVVLLVRPFVNISAGVYFGVFVGNLCFaINYFIFVIFFV-LFVYEIFVALMHW 159
107735932  82 AEMVPNGSPSWILPFIPHIEIISFIIRPIVLLLRPFINISVGIYAGLTIGDLCIlFNNYIFIFFLFaFFIYEVFVIVVHW 161
190349540  78 CSFTPVGAPIVIAPFVCIAEGISYIVRPFVLILRPFLNLTIGAFGALSLGGLIStSINPIIFMLFIfIFFYEIFVSLVHW 157
195952372  81 SCFIPLGTPLWIAPFVCLAETLSYVVRPVVLMMRPFVNLSAGALGGYALGVLSL-FNSWVVLFLIL-LFFYEIFVAVVHW 158
224588103  81 SCFVPMGTPLWIAPFVCLAETLSYIVRPGVLMMRPFVNLSAGALGGYALGLLSM-FSYWVVMFLVV-LFFYEIFVAVVHW 158
12249170  160 FIVCNILSFSENH 172
12249158  161 FIVSEILKFSVDH 173
107735989 161 FIVEEILKFSVLH 173
8573071   158 FIVCNILSFSEDH 170
12249136  161 FIVQEILKFSVDH 173
12249148  160 FIVQEILKFSVDH 172
107735932 162 FIINEILKFTIFH 174
190349540 158 FIVSNILIFSIDH 170
195952372 159 FIVYSILSFSEDH 171
224588103 159 FIVYSILSFSEDH 171
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap