Conserved Protein Domain Family
COX3

?
MTH00049: COX3 
cytochrome c oxidase subunit III; Validated
Statistics
?
PSSM-Id: 177124
View PSSM: MTH00049
Aligned: 31 rows
Threshold Bit Score: 177.03
Threshold Setting Gi: 123170291
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
107735923   1 MSYFSVVNLILVFFLLPCIFFYHPWWLLGFVAIWLVLYFRYISWeFVLLVHSQCKIGFWLFIMSEVVIFLTLMFNCFWFN 80 
12249161    1 MSYFSLVNLVLFFAVLPCIFFYHPFIMTVVLCVWVYLFRKYVVW-DIFMLRISCKMAFWLFLASELIVFLTIIFCCFWYI 79 
153127298   1 MNWASLYSSAIFSLMLIGLILWIPLLVLFGFIMTVAGTLWFLND-TFVQTS-HYLNGFFLFILSEVLIFASLFVTCLWFR 78 
153126963   1 MSLFSIVNIVFVVFVLPCIFFFHPFILLVGLVTWFFVFLKFVGG-DLCSIKFYYKIGFWLFLLSEVIVFGSLLTCCLWFQ 79 
123170291   1 MNWASLYSSGIFSLMLIGLILWIPLLVLFGLIMIVVGMLWFLND-TFVQTS-HYLNGFFLFILSEVLIFASLFVTCLWFR 78 
8573068     1 MSWLPLYNSWMFLVALLSLFFWKLVGVFFLFGLAALSVVLLIRE-VASYKV-HYEFGFWLFIFSEVAIFGTLFVMCLWSM 78 
107735980   1 MSYFSLVNLVLIFFLLPCIFFYHPWIFIINLILWLVLYFNLLSWdLFQLHNKSCKISFWLFIISEVIIFLTLMFSCFWFN 80 
190349549   1 MNWASLYSSIIFSFMLIGLILWIPLLVLSGFIMTLVGVVWFLND-TFVNTS-HYLNGFFLFILSEVLIFASLFVTCLWFR 78 
195952368   1 MSWLPFQAAWVIFMGIVNFFYWFVMWPLVFFVLSCFVVVLVIRE-VVLQRLQRHTSAFWLFISGEALLFGSLFAGVMWGE 79 
224588099   1 MSWLPFQAAWSIFMGVVNFFYWFVMWPLVFFALSVFVVVLVVRE-VVLQRLRRHSSAFWLFLSGEVILFGSLFVGVSWGE 79 
107735923  81 DIENISISYSFSVPIIETYLLVMSSLMISMFHSGVASDHSSKYIYLALLFSLVFICFAVDEFFNSSFNSLCSPYYASCFM 160
12249161   80 KGSSVAISYPLGIPILETYLLIMSSFFISAFHSNLASVNGRIFVYLSLVCSLLFIFFAVDEFLNSVVNSLCDPYYASCFM 159
153127298  79 DPNDINISEYNELPLLGSFLLLGSSVTATCYH--LQMKLSSLHLILTILLGVLFIVLQGVEYDESTVNLFSSVYHASCFT 156
153126963  80 VLDSECLAYAYFIPLVETVLLVGSSFFISAYHCLVSSARGVLYLYITLFSALLFMFLAIYEILGSVTSSLFNPHAACCFM 159
123170291  79 DPNDINISEYNELPLLGSFLLLGSSVTATCYH--LQMKLSSLHLILTILLGVLFIVLQGVEYDESTVNLFSSVYHASCFT 156
8573068    79 DGVMEPISSAVELPLLGSFLLIGSSVTATTYHHCRGLEISWVFLGVTVLLGLSFVLLQVFEFYDCECDVLSDVYYAGAFC 158
107735980  81 NSHNITISYSFSVPLVETFLLIMSSIFVSLFHGSVVSSSSRSNIIFALLFSLVFIFFALDEFFNSLVNSLYNPYYASCFM 160
190349549  79 DSNDINISEYNELPLLGSFLLLGSSVTATCYH--LQMNLNSLQLVLTIVLGMLFIILQGVEYDESTVNLFSSVYHASCFT 156
195952368  80 ESGTGVLADGFEFPFVSCFLLLTSSVTMTVYHHCYGLNLGRWFLYLTMLLGALFVLVQVCEFYGSGTDSLYCSYFSASYL 159
224588099  80 ESGTGVLADGFEFPFVSCFLLLTSSVTITLYHHCYGLELGRWFLYLTMLLGSLFVLVQVFEFYGSGTDSLYCSYFSASYL 159
107735923 161 LVGLHLSHVVVGSLGLIELIHFNESELVRSKSEMIVIYWHFVDFIWLLVFIVVYIS 216
12249161  160 LVGLHLSHVILGSFGLYELSGFQLSSFIRWKNNMLIVYWHFVDYIWLLVYLVVYIV 215
153127298 157 TISLHFSHVLIGVFLLGGLLLYTPKMVKLYYSNLVIWYWHFVDYIWLLVYSIVYIF 212
153126963 160 TVGLHFSHVLIGSVLLVQLLYFSSFRYVRRNSDMYIIYWHFVDYVWLFVFSIVYLS 215
123170291 157 TISLHFSHVLIGIFLLGGLLLYTPSVVKLYYSNLVIWYWHFVDYIWLLVYSVVYIF 212
8573068   159 TVGLHFSHVFVGVVGLSTLMLLGANAVKQCYANVAVWYWHFVDYVWLFVFLLLYLL 214
107735980 161 LVGLHLSHVVIGSVGLLELLEFNQCILVRSKSEMLVIYWHFVDFIWLFVFMVVYIF 216
190349549 157 TISLHFSHVLIGLFLLCGLLIYTPKMVKLYYSNLVIWYWHFVGYIWLLVYSVVYIF 212
195952368 160 TVGLHFTHVVVGLLAMLFLLIIGPEE-QYYYSSLVVWYWHFVDYVWLWVYLLIYYN 214
224588099 160 TVGLHFTHVVVGLLAMVFLLIIGAEE-QYYYSSLVVWYWHFVDYVWLWVYLLIYY- 213
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap