Conserved Protein Domain Family
COX1

?
MTH00048: COX1 
cytochrome c oxidase subunit I; Provisional
Statistics
?
PSSM-Id: 177123
View PSSM: MTH00048
Aligned: 33 rows
Threshold Bit Score: 759.984
Threshold Setting Gi: 299829115
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
123170292   1 MNYLSSWLFTLDHKRIGIVYSIVGVWAGFVGLGLSILIRIQLSDPYFNIIPFEVYNYVITSHGIIMIFFFLMPVLIGGFG 80 
159106776   1 ---MFTWLFTLDHKRIGMIYMVLGIWGGFLGLSLSMLIRLNYLDPYYNIVSSEVYNYVLTNHGVAMIFFFLMPVLIGGFG 77 
15277409    1 --DLISWFVSLDHKRVGVVYIILGVWGGFIGLGLSLLIRLNFCDPYYNLIPCEVYNYLITNHGIAMIFFFLMPVLIGGFG 78 
153127294   1 MNYLSSWLFTLDHKRIGIIYSIVGVWAGFVGLGLSILIRIQLSDPYFNIIPFEVYNYVITSHGIIMIFFFLMPVLIGGFG 80 
12249174    1 ----MSWLFTLDHKRVGLIYMVIGLWGGFFGLSLSVLVRLNYLDPYFNLVSPEVYNYVVTGHGIIMIFFFLMPVLIGGFG 76 
15283978    1 --DLVIWFVSLDHKRIGIIYMIMGIWGGFIGLGLSMLIRLNFCDPYYNLIPCEIYNYLITNHGIAMIFFFLMPLLIGGFG 78 
153126970   2 ILSYFSWLVSLDHKRIGVIYFLLGLWGGFIGLGLSLLIRLNFCEPYYNLVPSEIYNYLITNHGIAMIFFFLMPVLIGGFG 81 
190349541   1 MNYALSWLFTLDHKRIGIIYSIVGVWAGFVGLGLSILIRIQLSDPYFNIIPFEVYNYVITSHGIIMIFFFLMPVLIGGFG 80 
195952376   1 --MSAIWLFTMDHKRIGIIYMILGVWGGFTGLSLSFLIRINYFDPYFNVVSPDVYNYVATSHGVAMIFFFLMPVLIGGFG 78 
224588107   1 --MSAIWLLTMDHKRIGVIYMILGIWGGFLGLGLSFLIRVNYFDPYFNVISSDVYNYVVTSHGVAMIFFFLMPVLVGGFG 78 
123170292  81 NILLPILLNLNDLNLPRLNALSAWLLMPSMVLVFASMWFGSGTGWTFYPPLSGASFSPSIGTDFLMFSLHLSGISSIFSS 160
159106776  78 NYLLPLLLGIPDLSLPRLNALSAWLMLPSAVCLSLSMLGGAGVGWTFYPPLSGGDYS-GWGVDFLMFSLHLAGLSSLLGS 156
15277409   79 NYLLPFFLSMSDLALPRLNSLSVWMMVPSIFYMELSLYYGSGVGWTFYPPLSSLATS-GVGVDYLMFSLHLAGVSSLIGS 157
153127294  81 NILLPILLNLNDLNLPRLNALSAWLLMPSMVLVFASIWFGSGTGWTFYPPLSGASFSPSIGTDFLMFSLHLSGISSIFSS 160
12249174   77 NYLLPLLLGIPDLNLPRLNALSAWLLFPACVCLPFGLIGGVGVGWTFYPPLSSLDYS-SWGVDFLMFSLHLAGVSSLLGS 155
15283978   79 NYFLPFFLCLDDLALPRLNSFSVWVMVPSIFYMELSLYYGSGVGWTFYPPLSSQATS-GVGVDYLMFSLHLAGISSLIGS 157
153126970  82 NYLLPFLLGLDDLALPRLNSLSVWLMVPSMFYMELSLVYGAGVGWTFYPPLSIQSSM-GVGVDYLMFSLHLAGVSSLLGS 160
190349541  81 NILLPILLNLNDLNLPRLNALSAWLLMPSMVLVFASIWFGSGTGWTFYPPLSGASFSPSVGTDFLMFSLHLSGISSIFSS 160
195952376  79 NYLLPLLLGLSDLNLPRLNALSVWLLVPSALCFSLSMYGGAGVGWTFYPPLSSGDYS-GWGVDFLMFSLHLAGLSSLFGS 157
224588107  79 NYLLPLLLGLSDLNLPRLNALSVWLLVPSAVCFSLSMYGGAGVGWTFYPPLSASDYS-GWGVDFLMFSLHLAGLSSLFGS 157
123170292 161 LNFICTIISAWGVSVNIKdTAIVIWAYLFTSILLILSLPVLAAGITMLLFDRNFNSSFFDPVGGGDPVLFQHLFWFFGHP 240
159106776 157 LNFICTIVSALCEHTVGR-SSIIVWAYLFTSVLLLLSLPVLAAAITMLLFDRNFSSAFFDPLGGGDPVLFQHLFWFFGHP 235
15277409  158 INFITTIML----RLSSC-SSVISWSYLFTSVLLLLSLPVLAAGITMLLFDRNFGTAFFEPAGGGDPVLFQHLFWFFGHP 232
153127294 161 LNFICTIISAWGVSVNIKdTAIVIWAYLFTSILLILSLPVLAAGITMLLFDRNFNSSFFDPVGGGDPVLFQHLFWFFGHP 240
12249174  156 INFICTILEVMLDEGTGR-HSILVWAYLFTSVLLLLSLPVLAAAITMLLFDRNFGSAFFDPMGGGDPVLFQHLFWFFGHP 234
15283978  158 VNFITTIMI----RLNSC-SSVISWSYFFTSILLLISLPVLAAGITMLLFDRNFGTAFFEPAGGGDPVLFQHLFWFFGHP 232
153126970 161 VNFITTILL----NLSFR-VSVIVWSYLFTSILLLLSLPVLAAGITMLLFDRNFGTAFFEPCGGGDPILFQHLFWFFGHP 235
190349541 161 LNFICTIISAWGVSVNVKdTAIVIWAYLFTSILLILSLPVLAAGITMLLFDRNFNSSFFDPVGGGDPVLFQHLFWFFGHP 240
195952376 158 LNFICTIWSAMDKRVLER-HSIIIWAYLFTSFLLLGTLPVLAAAITMLLFDRNFGTVFFDPSGGGDPVLFQHMFWFFGHP 236
224588107 158 LNFICTIWSAADSRVSER-HSIIVWAYLFTSILLLGTLPVLAAGITMLLFDRNFGTVFFDPSGGGDPLLFQHMFWFFGHP 236
123170292 241 EVYVLILPAFGMISHICITLSNGEQPFGYYGMVFAMFSIVCLGSVVWAHHMFSIGMDVKTSVFFSSVTMIIAVPTGIKIF 320
159106776 236 EVYVLILPGFGIVSHICMTLTNNDSLFGYYGLVFAMGAIVCLGSVVWAHHMFMVGLDVKTAVFFSSVTGVIGIPTGIKVF 315
15277409  233 EVYVLILPGFGIVSHICMSLSNNNSSFGYYGLVCAMGSIVCLGSVVWAHHMFMVGMDVKTSVFFSSVTMIIGIPTGIKVF 312
153127294 241 EVYVLILPAFGMISHICITLSNGEQPFGYYGMVFAMFSIVCLGSVVWAHHMFSIGMDVKTSVFFSSVTMIIAVPTGIKIF 320
12249174  235 EVYVLILPGFGVISHICVTLTNNDSLFGYYGLILAMAAIVCLGSVVWAHHMFMVGLDVHTAVFFSSVTMVIGIPTGIKVF 314
15283978  233 EVYVLILPGFGIVSHICMTLSNNNSLFGYYGLVCAMGSIVCLGSVVWAHHMFMVGMDVKTAIFFSSVTMIIGIPTGIKVF 312
153126970 236 EVYVLILPGFGVVSHICMNLSNNDSSFGYYGLVCAMGSIVCLGSVVWAHHMFMVGLDVKTAVFFSSVTMVIGIPTGIKVF 315
190349541 241 EVYVLILPAFGMISHICITLSNGEQPFGYYGMVFAMFSIVCLGSVVWAHHMFSIGMDVKTSVFFSSVTMIIAVPTGIKIF 320
195952376 237 EVYVLILPGFGMISHVCTTLTGNDSLFGYGGLVLAMFAIVCLGSVVWAHHMFTVGLDLGTAIFFSSVTMIIGVPTGIKVF 316
224588107 237 EVYVLILPGFGMISHICTTLTGNDSLFGYGGLVLAMFAIVCLGSVVWAHHMFTVGLDLGTAVFFSSVTMIIGVPTGIKVF 316
123170292 321 TWLYML-TSSSNKANNPIVWWVYGFIILFTIGGVTGIVLSSSVLDVMLHDTWFVVAHFHYVFSLGSYSGVVLSAIWWWPL 399
159106776 316 SWLFML-GGTRLRFWDPVLWWILGFIFLFTIGGVTGIILSSSILDSLLHDTWFVVAHFHYVLSLGSYSTVVISLLWWWPV 394
15277409  313 SWLYML-GSSGLRAADPILWWIVGFIFLFTVGGVTGIVLSASALDSLFHDTWFVIAHFHYVLSLGSYSSVIIMFVWWWPF 391
153127294 321 TWLYML-TSSSNKANNPIVWWVYGFIILFTIGGVTGIVLSSSVLDVMLHDTWFVVAHFHYVFSLGSYSGVVLSTIWWWPL 399
12249174  315 SWLIMLgGGSSVRIWDPVVWWIIGFIVLFTIGGVTGIMLSASLLDTLLHDTWFVVAHFHYVLSLGSYSSVVISFIWWWPV 394
15283978  313 SWLYML-SGCGLRVIDPVVWWIVGFIFLFTVGGVTGIVLSASSLDSLFHDTWFVVAHFHYVLSLGSYSSLIIMILWWWPF 391
153126970 316 SWLYML-GTSYLRGVEPIVLWVLGFIFLFTVGGVTGIVLSASVLDSLFHDTWFVIAHFHYVLSLGSYSTVVISLIWWWPV 394
190349541 321 TWLYML-SSSSNKFNNPIVWWVYGFIILFTIGGVTGIVLSSSVLDVMLHDTWFVVAHFHYVFSLGSYSGVVLSTIWWWPL 399
195952376 317 SWLYML-AGTRDRLWDPIMWWIIGFIVLFTIGGVTGIVLSASVIDALFHDTWFVIAHFHYVLSLGSFSTVVISMIWWWPV 395
224588107 317 SWLYML-AGTRERLWDPIMWWIIGFVVLFTIGGVTGIVLSASVIDALFHDTWFVIAHFHYVLSLGSFSTVVISVIWWWPV 395
123170292 400 LTGLNLSSILLKAHFILSMVGFNLCFFPIHYFGLCGLPRRVCLYDDSFYWINILSSLGSLISGLTAFMFFYILWESFNSR 479
159106776 395 VTGFSLNKYLLQGHWVSSMLGFNLCFFPMHYLGAYGLPRRVCNYEPAFQWLNNISSVGALVSVVSAFFLVFILWESLVVG 474
15277409  392 IIGCSLNKYLLQGHWLLSMVGFNLCFFPMHYLGVHGLPRRVSCYDPEFYLVNVFSSIGGVLSVTSSMVFMFLLWESLSVY 471
153127294 400 LTGLNLSSILLKAHFILSMVGFNLCFFPIHYFGLCGLPRRVCLYDDSFYWINIVSSLGSLISGLTAFMFFYILWESFNSR 479
12249174  395 VTGYSLNLFMLQGHWVVSMIGFNMCFFPMHYLGMAGLPRRVCVYDPDFYWLSVVSSLGALVSAGSAFLFVFILWESFVVG 474
15283978  392 IIGCSLNKYLLQGHWLLSMVGFNLCFFPMHYLGMHGLPRRVSCYDPEFYVVNVFSTIGGILSVTSSMVFMFIIWESLSVF 471
153126970 395 IIGYSLNKYLLYGHWFLSMVGFNLCFFPMHYLGMHGLPRRVCCYDPEFYWVNVVCSVGGVLSVVSSMIFLFILWESITVG 474
190349541 400 LTGLSLSNILLKAHFVLSMIGFNLCFFPIHYFGLCGLPRRVCLYDDSFYWINIMSSLGSLVSGLTAFMFFYILWESFNSR 479
195952376 396 FTGFSLNKYLLVAHWGVSMIGFNLCFFPMHFLGVYGLPRRVCSYEPCFQWINTLCSIGGIFSVFSGFTLMYIVWESIAVS 475
224588107 396 FTGYSLNKYLLMAHWGVSMTGFNLCFFPMHFLGVYGLPRRVCSYEPCFQWLNTLCSMGAIFSVFSGFTLMYIVWESMAVC 475
123170292 480 RIVLGLWNESSSVVNGLNGSLKYHVQFT-----------SIFRT 512
159106776 475 NRVVGIWGTNALVVNALVTPVPHHSIYIsgpsrwlsf------- 511
15277409  472 NCVLGLWGSCGCVCNVLTCPTSYHIDYIadgknwsky------- 508
153127294 480 RIVLGLWNESSSVVNGLNGSLKYHVEFT-----------SIFRT 512
12249174  475 NCVVSSWGSSSLVLNVITLPGPQHNSYMngvgrwvf-------- 510
15283978  472 NRILGLWGPGSCICNVVTIPVPSHIGYMvngkywtwgnk----- 510
153126970 475 NRVLGLWGSGSFPLNVVTVPTPYHASYMssvklwvti------- 511
190349541 480 RIVLGLWNESSSVVNGLNGSLKYHVEFT-----------SIFRT 512
195952376 476 NRVVHLWGGAHVVFNVLVNPIGAHSSYLhypicwmpsggRRLEG 519
224588107 476 NRVINLWGGAHVVFNVLVNPIGAHSPYLhypvcwvpseiRRLGV 519
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap