Conserved Protein Domain Family
CYTB

?
MTH00046: CYTB 
cytochrome b; Validated
Statistics
?
PSSM-Id: 177121
View PSSM: MTH00046
Aligned: 32 rows
Threshold Bit Score: 446.352
Threshold Setting Gi: 107735981
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
123170294   1 MISIIKSNIYDLPTNSGLNYYWCSGFVLGGTIAIQVLTGALLSLLYVADQNISFgcvMGFSNEELSLWLVRYFHIWGASG 80 
12249162    1 MKKLIVGNLVDLPISIGLNYYWCVGFILGIFMVVQVISGVVLSLFYSSISSFSF---LVWADDNLFSWFVRYLHIWGVSV 77 
153126962   1 MIILLRGNLVDLPTNLSLSYFWCGGFMLSIFMVIQVLSGIILSLFYGAEN--NFtlvFMGFDESILIWLVRYTHIWCVNI 78 
8573069     1 MLSVLRYNVVDLPTNLSLNYFWCGGFMISGFLALQLVSGVVLSLLYVADSEMSFgcvLDFTNESLFVWLVRYLHVWGVTF 80 
107735924   1 MWKLVCNNLIDLPTSLGLSYLWCIGFVLSVFMIIQVITGIILSMFY---NSFNNfcfIVWADDNFIYWMVRYLHIWGVSV 77 
12249133    1 MLKIIRFNLIDLPTNLSITYFWCVGFMISAFMIIQVFSGIVLSLFY--DVLGNFsmlMMWTDDNIYCWIIRYIHIWCVSI 78 
12249168    1 MLAVMRGNVVDLPTNISLSYFWCGGFMISSFLIIQVLSGVVLSLLYVADSLLSFgcvLDFTSEGLFLWLVRYAHIWGVTF 80 
107735981   1 MKKLLINNLVDLPTSVGLNYFWCVGFLLSFFMLFQVLTGVFLSLFYSSLINFGF---LAWADESVSCWLIRYLHIWGVSV 77 
195952369   1 MLSIVRANVVDLPTNLSLSYFWCGGFMISVFLVLQVVSGVILSLLYVADASMSFscvLGFVGEDLFVWFVRYLHVWGVTF 80 
224588100   1 MLSIVRTNVVDLPTNLSLSYFWCGGFMISVFLVLQVVSGVILSLLYVADTGVSFgcvLSFIGEDLFIWFVRYLHVWGVTF 80 
123170294  81 IFLIMFIHMGRALYYGSYNKGFVWSIGFILYLLMMVEAFLGYILPWHQMSFWAATVLTGVVQSVPFIGELVYNYIVGGFG 160
12249162   78 MFFLLYVHIGRGLYYSSYNKVAVWSSGFLLYLLIMIEAFLGYILPWHQMSYWAATVLTSVILSIPLFGSLLYTYIVGGYS 157
153126962  79 VFVLLLIHIGRSLYYGSYSRLGVWNVGFVLYIMIMVEAFLGYILPWHQMSYWAATVLTSILSSVPFVGTNLYSYVVGGFG 158
8573069    81 IFVLFFAHMGRALYYSSYSKVAVWNVGFVLYLLMMVEAFLGYILPWHQMSYWAATVLTSILNSVPIVGGSLYTFIVGGFG 160
107735924  78 IFVLLYIHICRGLYYSSYSKVLIWSSGFILYLLVMVEAFLGYVLPWHQMSYWAATVLTSIVLSVPIFGSSIYSYIVGGYS 157
12249133   79 IFFLVYVHIGRSLYYSSYRMIGVWNVGFFIYVILMVEAFLGYILPWHQMSYWAATVLTSIILSVPVVGGLIFSYVVGGFS 158
12249168   81 IFLLFFAHMGRALYYSSYSKLGVWNVGFVLYLLMMVEAFLGYILPWHQMSFWAATVLTSILQSVPFVGGVLYEYVVGGFS 160
107735981  78 IFVLLYIHICRGLYYSSYKKISVWNTGFILYLLIMIEAFIGYILPWRQMSYWAATVLTSIILSIPFFGSFVYSYIVGGFS 157
195952369  81 IFVLFLVHMGRSFYYSSYSKLGVWNVGFVLYILMMVEAFLGYILPWHQMSYWAATVLTSILQSVPVVGGQLYSFIVGGFG 160
224588100  81 IFVLFLVHMGRSFYYSSYSKLGVWNVGFILYIVMMVEAFLGYILPWHQMSYWAATVLTSILQSVPVVGGSLYNFIVGGFG 160
123170294 161 VT-NVTLVRMFAAHIIIAFLILGLIGVHLFYLHKQGSNNSLSLSNGYSDSVYFHHYYSTKDLLAVSMFVNLLIIVMLVSP 239
12249162  158 VTvTETLLRFFPMHVVLGIIILVLVLFHLYYLHSVGSSMPLYISDSYSDCVYFHKYYSIKDVFVIVGVFVMLLTCMFVVP 237
153126962 159 VTvGETLLRVFPAHVILGIVILGVVIIHLFYLHKSGSSCPLFISGGYSDCVYFHGYYTVKDLYVFIVISFFCIFLMIFIP 238
8573069   161 VT-NATLIRVFSAHVCLAFVIVGFSVIHLFYLHKGGSNNPLFVSGGYSDVVMFHSFFTNKDGLVLLGLLVLLGGLVWVCP 239
107735924 158 VTvNETLVRFFSVHIILGIGLLGLIMLHLFYLHKTGSSVPLFLYSSYSDNVYFHKYYTIKDFFVFMFILMILFMFVISSP 237
12249133  159 VTlIDTLVRVFPVHISLGFILLGLIVLHLFYLHQSGSTSPLFFYNGYSDCVYFHSYHTIKDLFAFMVVIVFSNFLVLVDP 238
12249168  161 VT-NIMLVRVFSAHVCLAFVILGFSVIHLFYLHKGGSNNPLFVSGGYGDVVFFHSFFTSKDGFVLLCLLFFFGVCMLVFP 239
107735981 158 VTiDETLLRFFPIHIILGVALLGLVLVHLFYLHLIGSSSPLFINNSYSDSIYFHKYYSIKDLYSFLWVLLVLLCFMLYDP 237
195952369 161 VT-NVTLVRVFSAHVCLAFVIIGFSVVHLFYLHSSGSNNPLSVSGGYSDVVLFHSYFTVKDGLVLVFLLFLLGGLLLVSP 239
224588100 161 VT-NVTLVRVFSAHVCLAFVIIGFSVMHLFYLHSSGSNNPLSVSGGYSDVVLFHSYFTVKDGLVLVFLLFLLGMLLLVSP 239
123170294 240 DLALDSEAYLRADPMTTPANIKPEWYFLFYYAMLRSISSKIGGLVLVITFLLILWVPfsNNKNGSAYSLLYQSNFWWIAS 319
12249162  238 HCVLDCESFIEANFLVTPENIKPEWYFLLYYAMLRSVNSKLGGLLIVLIFLFVLWLP--SSNISCIYSVFRQVNFWLLLS 315
153126962 239 NMVLDVEAFIKADPLVTPASIKPEWYFLIYYAMLRSIESKVGGLVFVLSFLLVLWVP--TKNISSCYSLLRQVVFWCLFG 316
8573069   240 DMVLDVESYLQADPLVTPVSIKPEWYFLAFYAMLRSVESKVGGLVLVLVFLFALWLP--SFNGSCCYFLGRQYIFWGVAS 317
107735924 238 NLVLDCEAFTEANLLVTPSNIKPEWYFLGYYAILRSINSKLGGLVFVLVILFVIWVP--NNNYSCIYSFSRQLVFWFIVS 315
12249133  239 NIILDVEAFIVANPLVTPDSIKPEWYFLLFYAMLRSINSKVGGLVLVILFLLVLWFP--SKNFSSIYVFSRQVCFWLVVS 316
12249168  240 DLVLDVESYIQADPMVTPASIKPEWYFLSFYAMLRSVESKVGGLVLVLVFLFLLWLP--TLNKACTYSIGRQYIFWCGVS 317
107735981 238 NLVLDCEAFSEANSLVTPSNIKPEWYFLSYYAILRSVSSKLGGLVLVLVILTLVWVP--AFNISCIYSIFRQVLYWIIVV 315
195952369 240 DCVLDVESYIQADPMVTPVSIKPEWYFLAFYAMLRSVESKVGGLVLVIVFLFLVWLP--TFNGSCVYSAGRQLVFWSCCS 317
224588100 240 DCVLDVESYIQADPLVTPVSIKPEWYFLAFYAMLRSVESKVGGLILVLVFLFLMWLP--TFNESCVYSVVRQFVFWSSCS 317
123170294 320 TLFVLSYLGACHPEWPYDWISFICSMSVIVLLLVLKFV 357
12249162  316 FCVGLGYIGACHAEYPYNLIAQYYSFLVLFLLTIFKFS 353
153126962 317 LYIILSYLGGCHAEYPYILISKICSVLMLFFVSLYKGC 354
8573069   318 MFFLLSYLGACHPEDPYILVSKFSSLVVVFFLFLFKGL 355
107735924 316 LGVQLSYIGACHAEYPYGLVSQVSSIIFLCFLVIYKMF 353
12249133  317 LFVALSYLGGCHAEYPYIDVSKVCSLMMLSILFIYKFF 354
12249168  318 CFLLLTYLGACHPEPPFVLISKFASLLVVLLLVMFKGL 355
107735981 316 LSMGLGYMGSCHVEYPYTVISQLWSIILLCALVIYKVF 353
195952369 318 VFFLLSYLGACHPEFPFVLISKASSALIIFFLMGFKGL 355
224588100 318 VFFLLSYLGACHPEFPFVFISKASSVLIILFLMSFKGL 355
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap