Conserved Protein Domain Family
ND6

?
MTH00045: ND6 
NADH dehydrogenase subunit 6; Validated
Statistics
?
PSSM-Id: 177120
View PSSM: MTH00045
Aligned: 29 rows
Threshold Bit Score: 87.2683
Threshold Setting Gi: 41057404
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
84488733    1 MSLYISVITLLFGSSFVFYSLSPYYSALGLAIVSISGCLILTHISASFLALILLLVYMGGMLVVFVYSSALSTDRFPYIS 80 
5835469     1 MNTYILVISLLFGSSLVFYSISPYFSALGLVTVSISSCLILSHLGISFLAFILLLIYMGGMLIVFIYSNALTNDRFPIIS 80 
84488830    1 MNIYISIILTLLGTSLVFYSLSPYFSALGLVIVSISSCLILLQTGMNFLALIILLVYMGGMLIVFIYSSALSAERFPTIS 80 
188039024   1 -MIELIVMIILLGSLVLVFSGSPYFGLFGVLIQSIGFSLYLFFCGLPFFGLLMVLVYVGGMMVVFLFSTILSAERYPGTS 79 
188039038   1 MSIFLINITLLFGSSLVFYSISPYFSALGLVIVSISSCFLLSKIGISFLALILLLVYMGGMLIVFIYSSAITNDRFPTIS 80 
49147342    1 -MVELVVIAIFSGCLVLVFSGSPYFGLFGVLLQSIGFSLLLFLLGLPFFSLLTVLVYVGGMMIVFLFSTILSAERYPGSS 79 
289183176   1 MMIVLIVISLIFGICIVFASRSPYFGIFGVLLQALSFSLLLCLFGLPFFGLLTILIYVGGMLIIFLFSTVLSAERYPDSG 80 
289183247   1 MVIYLCLVFMLVGSTLVFYSLSPYYSALGLVVVSVSGCVVLGVLGGSFVALVLLLVYMGGMLVVFAYSSAISAERFPSVS 80 
289183216   1 -MVSLFIFAIISGSVIVLWSSSPYYSVLGVLLQSLGYCFFLCFFGFPFFGLIFLLVYVGGMMVVFLFSTVLSAERYLNSS 79 
41057404    1 -MLTLVLLLIDGGALFLIFSSSPFFSVFGVLAHCLGHSLLLSFMGVPFISLLLIVIYAGGMLVVFLFSTILSAEQYP--- 76 
84488733   81 NTAEIISLSFFIIVWTTILYNNTNwNTTNTNFNLTSLVDIEGASYLFHqSMILFFILAGYILLIALIIVLDISRGVEETS 160
5835469    81 NINEIFTLSFFLIFWTIFLLNNQNwNNINNNTNLSSSINIEGASYLFHiSMAPFFLLAGYILLITLIAVLDISRGIENST 160
84488830   81 NINEIITLCLFILFWNIILFENNN-WNSVNNTNISNSISIEGASYLFSpTMIWFFLFAGYILLISLIAVLNISQENESGS 159
188039024  80 -WSEFFVFSLCLILLVYPSLSSWH--LFGSPLSLGGLSSELGYMEVFN-SLGLLTCLIAFVLLVALVVVLIVGFEHSESS 155
188039038  81 NINEITILSIIFLFWNVILINNNNwQNISINNNLSNSVSIEGSSYIFHySMAPFFILSGYILLISLLAVLNISRGNDDSS 160
49147342   80 -WSEFLVFLFSICLLVIPSLSPWF--LSARNVSMSSLSSELGFCEVFN-SLGYFTCFLAFILLVALVVVLVISFEHSQSS 155
289183176  81 -WLEALSLSLVLLLLGGSLIDSWS-SLSNDQLTLLNLNNENSLGEVFS-GYGLVVLLVVLGLLMALLIVLAFGYEHSRIT 157
289183247  81 NLSEVVGLSLFFSTWVFVSFNDLN-DTNNNFFQLISGESVLGSSSFYN-EGGALVIVGVFILLVALVGALIISRGVESTI 158
289183216  80 -ILEVLFFLFSFNIIILPYLEFLF--PWIYGFSFLSLSKEIQVCELMG-SLMFLTCLVAFILFVSLLVVFSLCFEHGRVS 155
41057404   77 SVDSLFFTFLWGGLFILTSPFLFV-GWSPLLGESYGGLVLTESYSFLFlGVGLISLLVGLILLVGLIAVLELGFEHGLKS 155
84488733  161 LRAL 164
5835469   161 LRAL 164
84488830  160 LQAL 163
188039024 156 LRK- 158
188039038 161 LRA- 163
49147342  156 LRKL 159
289183176 158 LRKL 161
289183247 159 VRAI 162
289183216 156 LRKL 159
41057404  156 LRKL 159
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap