Conserved Protein Domain Family
ND3

?
MTH00042: ND3 
NADH dehydrogenase subunit 3; Validated
Statistics
?
PSSM-Id: 177117
View PSSM: MTH00042
Aligned: 24 rows
Threshold Bit Score: 120.086
Threshold Setting Gi: 188039021
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
84488827    1 MNNFVFVLFVVVMVVGLLCFFIYFLPLHLPNKNKSSPYECGFDPLNSARVPFSFRFFLVAILFLLFDLEIALLFPIPYSf 80 
57854575    1 MYNTIIIVFSILFVTAILVVAAHFLPSRNLDLEKASPYECGFDPLNSARVPFSFRFFLVAILFLLFDLEIALLFPFPQA- 79 
86990384    1 MYNFAITLTSILLITGLITTAAHALPSRNIDLEKSSPYECGFDPLNHARIPFSFRFFLVAILFLLFDLEIALLFPFPVS- 79 
84488730    1 MGLFVFVFLGIVIVIILLVCLIHFLPSYVPDNQKGSPYECGFDPLNSARVPFSFRFFLVAILFLLFDLEIALLFPLPSAi 80 
28916744    1 MYNIIIIVLSILAVTAALVFAAHFLPSRKLDLENGSPYECGFDPLNSARVPFSFRFFLVAILFLLFDLEIALLFPFPQA- 79 
5835310     1 MTSMTFLIIITIIIASILGLAAHILPSRNADAEKSSPYECGFDPLNSARLPFSFRFFLVAILFLLFDLEIALLFPLPGA- 79 
5835466     1 MNGFIFVLLVVVIVLGLLCFLIYFLPSRLPDNQKSSPYECGFDPLNSARIPFSFRFFLVAILFLLFDLEISLLFPLPYSf 80 
188039034   1 MNSLVFVLLVIVIIVSLLCFLIYFLPSRSPDGQKVSPYECGFDPLNSARVPFSFRFFLVAILFLLFDLEIALLFPLPYSi 80 
289183257   1 MTSLSYIVLITLAIAAILTVAAHILPSRNTDSEKNSPYECGFDPLNSARLPFSFRFFLVAILFLLFDLEIALLFPLPAA- 79 
17648141    1 MTTTIFLFSITSAVAIIFALAAHILPTRNNDGEKNSPYECGFDPLNSARLPFSFRFFLVAILFLLFDLEIALLFPLPAA- 79 
84488827   81 TIILSSFYVVCISFFFIILLTLGLIYEWLNGGLEWAD 117
57854575   80 LFCLNPSFVLCIATLFLVILLIGLIFEWTQGGLDWAE 116
86990384   80 TFFMSPNTSLGLAIAFLLILTLGLAFEWSQGGLDWAE 116
84488730   81 TSVLDSVFVVVIGSCFVVILTLGLVYEWVNGGLEWAD 117
28916744   80 LFIFNSSHVLYIATLFLAILLIGLIFEWTQGGLDWAE 116
5835310    80 VLITNPSNLIIAATIFMFILTFGLVFEWINGGLEWAE 116
5835466    81 SVLLDQFFIIIISFFFIFILTIGLVYEWINGGLDWAD 117
188039034  81 SSLVGQDFILFLSLFFLYLLTVGLIYEWVNGGLDWAD 117
289183257  80 VLASHMSTLIPIATIFMTILTLGLVFEWVNGGLEWAE 116
17648141   80 SFLTHPTTLILISLAFMAILDAGLVFEWINPPLEWAE 116
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap