Conserved Protein Domain Family
ND2

?
MTH00041: ND2 
NADH dehydrogenase subunit 2; Validated
Statistics
?
PSSM-Id: 177116
View PSSM: MTH00041
Aligned: 26 rows
Threshold Bit Score: 261.404
Threshold Setting Gi: 188039040
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
86990334    1 MHRSVFIVLVISVVFGTFIVLSSHHWFTLWVGLEVNTLSILPILCGGFLPRKVESSVKYFLVQSVSAAVILNVVVIQAWF 80 
84488819    1 MNRITTSFFFTNIILGTIIVVSSNHWFLIWIGLEINTISILPILLSTQNRRNTEASIKYFIIQAIAATILLNAAIINTWN 80 
84488722    1 MNRNITTLFITNIIIGTIIAISSNHWFLIWIGLETNTLSIIPLLTFLQSPRNIEASIKYFLIQALAAATILNSALINAWT 80 
188039026   1 --MNNLLFYIGALMLSILGCSISSNWLVLWLWIELNSLALIPILSSNITPRSIEATSKYFLFQATGSVILLLGILFRHMN 78 
49147344    1 --MTSLLFYISSVLISIIGCGLSNNWILVWLWVELNSLALIPILSSNVTPRSIEATSKYFLFQAAGSAILLFGILLRNYN 78 
228015375   1 MNRLVNAFLLTSLIAGTSLVIFSNHWFPIWLGLELSTLSIIPLLSYTSQSRSVEATLKYFLVQAFSAALLLNGAVLNLWI 80 
49146286    1 MNRIIIIFLISSLVIGTTLVIFSNHWFPIWLGLELSTLSIIPILNTNIKSRSNEATTKYFLVQAFSAAILLNGATLNLWL 80 
261866664   1 MNRLVNAFLLTSLIAGTSLVIFSNHWFPIWLGLELSTLSIIPLLSYTSQSRSVEATLKYFLVQAFSAALLLNGAVLNLWI 80 
289183292   1 MNRIVILFLLLTLLSGTTLVLISKHWFPIWLGLELSTLSILPILSSNTWSRGNEATLKYFLVQAFSAAILLNGATLNLWL 80 
304322879   1 MNRLIIILLLTSLLIGTSLVLLSSHWFPIWLGLELSTLSIIPLLNMNGHSRSTEATLKYFLVQAFSAALLLNGAVLNLWL 80 
86990334   81 SSSWLVGQPLLSVSSVLITLAVGLKLGLFPCHYWFPDVVQGVGFLEGLVLSTWQKLAPFSVLVYVINSVDIRVLVCLGVL 160
84488819   81 NGSWLINSPLNTFSSNLITIALLLKISIWPFHFWYPEVINGISLINGLIITTWQKIGPTIITFLIINNLNINIITICSIS 160
84488722   81 NGSWLINTEFNEINCIIITGALFLKLSLAPFHIWFPDVISGINLLQGLLLTTWQKIAPLIITLNIINTLNLNMILYCSIL 160
188039026  79 SENLLIIGYYNTLELVIIIFALTLKMGIFPNHFWFIDVMQGINFLNGFFVSIISKIIPLYIIISINNSLTFFILYIIGVS 158
49147344   79 IDNLYISGPYSLLELFIIIFALTMKMGIFPNHFWFIDVMQGINFIGGFFVAILSKIIPIYLIISISGNPNQVILNVIGIS 158
228015375  81 SNSWDVNSITSPISYFIITAALIIKLGLAPCHFWFPDVLSGLPFLSTIIIACWQKIAPMLLLLSLSNLVSSEIIIVCSIL 160
49146286   81 SNSWNISETPNTISYIIILIAIIIKLGIAPCHFWFPDVLSGLPFSNGIIIACWQKIAPLFILLSISNNIPNEIILLCATL 160
261866664  81 SNSWDVNSITSPISYFIITAALIIKLGLAPCHFWFPDVLSGLPFLSTIIIACWQKIAPMFLLLSLSNLVSSEIIIICSIL 160
289183292  81 AGSWEISSTNDYLVHSIISLAIIIKLGLAPCHFWFPDVLSGISFNNGIIIACWQKIAPLVLIANLNNFLASELFILCAVL 160
304322879  81 SNSWSLAETSSPLCYYTISTALIIKLGLAPCHFWFPDVLSGISFPNVIIIACWQKVAPMFLLLSLSSYISSEILILCSTL 160
86990334  161 SVLIGGWGGLNQTQVRKILAFSSVAHMGWICSTVGYSVN--AGCIMLLVYVITNSSVFLIASEFDLKTLSHVGRLSYFSL 238
84488819  161 SIIISAWNGLNQTQTRKILSFSSINHISWIILISIYNQN--TSLTMFFIYIIINTAIFISLINNNTTNIANANKNIIINP 238
84488722  161 SIIIGAWNGLNQTQTRKILAYSSISHIGWITITGIFNQN--ASIIMLLIYITINTSIFLSLTTTNIKNIANINKNN--AT 236
188039026 159 SVLIGSIFGVQQTQLRKLIALSSITHLGWMIILFANTSNnwIGILLFLSYIIMVTPLFWLGNIFAIEHLSKGVSLAG-NF 237
49147344  159 SVVIGSIFGVQQTQLRKLIALSSVAHLGWMIIIFATTGNnwLGITLFFSYAIMVTPLFWAGNMFSIEHLSKTINLSN-NS 237
228015375 161 SVLVGGWGGLNQISVRKILAYSSIGHLGWITCVAFFIPE--VSYLLFLFYILNNTAILLICHNGSLYYLSSLSKSNV-VP 237
49146286  161 SILIGGWGGLNQISIRKILAYSSISHLGWVSATLFFSPE--ASLILFSFYIINNTSIFLLCHNNNLLSLANLNKTNLILP 238
261866664 161 SVLVGGWGGLNQISVRKILAYSSIGHLGWITCVAFFIPE--VSYLLFLFYILNNTAILLICHNGSLYYLSSLSKSNV-VP 237
289183292 161 SVLVGAWGGLNQVSTRKILAYSSIGHMGWITCTLFFSVE--VAIILFLFYILNNALIFCICSSNTLSHLSTLSKING-NP 237
304322879 161 SVIVGGWGGLNQISTRKILAYSSISHLGWVTCASFFLPE--VSFLLFLFYIINNTAILLICNNSSLFSLSSLSKASI-IP 237
86990334  239 GGSAGMVLGVLSLGGLPPLFGFLIKFVSLKCLLESGSILASGFLVAGSLLSLFYYLRVSFNSSLVLFPQHSLVLFGWRgl 318
84488819  239 WNASLLSLTLLSLGGLPPLTGFLNKILAFNTLITNNIILSNIPLIISSLVSLFFYLRIALNTNMSSFPQNSILLINSR-- 316
84488722  237 WTAPTITLCILSLGGLPPLTGFLNKLISLNVLTQNNSTLTTIPLIVGSLISLFFYLRISFNSNLSLFPQNALTIINTR-- 314
188039026 238 TLMFTFIVSILSIAGFPPLLGFFYKWIIFYNIIGNSNFLVIGILIMASLLSLFYYINICINFYMNLWSPNKIIFNNFIse 317
49147344  238 MLNTTMCLTILSIAGFPPLLGFFYKWIMFLSIVQTENFLIISILILASLFSLYFYIQICLSFYMTYWPTIKIGFNNFY-- 315
228015375 238 ITAILFSIALLSLGGLPPLGGFINKVIPLIVFSLNGNNFIIPFFLIGSLISLFFYIRIVFNTSLTLFPQHSLNIVSFR-- 315
49146286  239 IT-LLFSIFLLSLGGLPPLGGFLNKLIPFIIFLNNINWIFIPSLIFGSLTSLYFYLRIVFNTSLTLFPNNSLNFLFN--- 314
261866664 238 ITAILFSIALLSLGGLPPLGGFINKVIPLIVFSLNGNNFIIPFFLIGSLISLFFYIRIVFNTSLTLFPQHSLNIVSFR-- 315
289183292 238 TSTLLFSLALLSLGGLPPLGGFINKLIPISIFAINNSLIIIPLFIIGSLISLYFYLRVTFNTSLTLFPQNSLSLVSTR-- 315
304322879 238 TNIILFSLALLSLGGLPPLGGFINKIVPLIIFSFNSSNIIIPLFLGGSLLNLFFYLRIVYNTSLTLFPQSSIILLSSR-- 315
86990334  319 lggNSGAVTVRGLVLCGGLSVSLLGLVSLPVFASLL 354
84488819  317 ------NKNNNININTLPLIISVSGIIIFPILLNIL 346
84488722  315 -----NTTPSNTNTNSILITLALNSIIAPPILISIL 345
188039026 318 -iiNNNLITVTIVIANLLLFILIWNLAPISSTLNF- 351
49147344  316 ---SNKPVGHYLHEQPSRQNILLFYLIWIVSPLSSF 348
228015375 316 ----TGNKSLSQPIISTLIPITIWGLLLLPIFFLFI 347
49146286  315 ---NNNNSNYLNTIISILTPLPIFGLVLIPTFSLFI 347
261866664 316 ----TGNSGLSQPIISTLIPITIWGLLLLPIFFLFI 347
289183292 316 ----TTGTSYHSVAISILAPLTLWGILLVPLLYLFI 347
304322879 316 ---NTSSQTISSFLISILFPLCLFGLLLLPPV---- 344
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap