Conserved Protein Domain Family
COX3

?
MTH00039: COX3 
cytochrome c oxidase subunit III; Validated
Statistics
?
PSSM-Id: 177114
View PSSM: MTH00039
Aligned: 24 rows
Threshold Bit Score: 421.444
Threshold Setting Gi: 188039033
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5835092     1 MTHQHPYHLVDQSPWPLTGAISALMMTSGLILWFHTNSNHLLLAGTILLLLTVINWWRDVIREATFQGSHTLPVNTGLRY 80 
41057400    5 FQHQHPFHMVDRSPWPIFSSCRG-VAHNSLICWFQGDNILTALTGIVTLTLVTTLWWRDVVREATFLGMHTTNVTTGLKI 83 
49147338    5 FSHQHPFHMVDRSPWPLGAAIGAMVTTTGLVSWFQGDNIFTAALGLITVTIILAFWWRDVIREATFLGMHTTFVVRGLKI 84 
5835465     1 MNHQHPYHLVDQSPWPIIASLGALISTIGLALWFHGFGFSVVFLGLCSLIFVSIFWWRDVIRESTFQGNHTNSVGVGLRF 80 
84488729    1 MSYQHSYHLVEQSPWPIMASLGALTVTLGLVVWFHCFSFLVVFLGLCSLLFVSVFWWRDVIRESTFQGCHTCAVGSGLRY 80 
84488826    1 MNHQHPYHLVDQSPWPLIASLGALISTVGLVLWFHGFSFFVVFLGLSSLIVVSIFWWRDVIRESTFQGHHTYSVGVGLRF 80 
188039033   1 MNHQHPFHMVDSSPWPIVASTGALISTLGLVLWFNGFSFFVVFLGLFSLVIVSIFWWRDVIRESTFQGNHTSSVSVGLRF 80 
188039020   5 FIHQHPFHMVDRSPWPLGAAIGAMVTTAGLVSWFQGDSINTAALGILTLIIIMTLWWRDVVREATFLGMHTSFVVRGLKI 84 
289183185   5 ITHQHPYHMVDRSPWPLGAAIGAFTITTGLVCWFQGDSFITTGFGLLLTIFIMILWWRDVIREATYLGMHTTIVIQGLKI 84 
289183156   5 IKHQHPFHMVDRSPWPIAGAIGALTTTTGLVSWFQGDNILTALLGLFILSITMILWWRDVIREATFLGMHTTHVVRGIKI 84 
5835092    81 GMILFITSEVCFFFAFFWAFFHSSLAPTVELGVSWPPTGISPINPFLVPLLNTAVLLSSGVTVTWAHHSILTQNRTEAIQ 160
41057400   84 GFLLFIVSEIMFFLSFFWAFFHSALTPTAEIGMSWPPSGINPINPWSVPLLNTAILLSSGASLTWSHHALRDKEGNDALN 163
49147338   85 GFILFIVSEIMFFFSFFWAFFHSALSPTSEIGMSWPPTGIQSINPWGVPLLNTAVLLSSGASLTWSHHSLREGNGSEAWI 164
5835465    81 GMVLFITSEVLFFFAFFWAFFHSSLAPAVELGVCWPPFGINPLDPFLIPLLNTAVLLSSGVTITWSHHSILEKNWLGAVQ 160
84488729   81 GMVLFITSEVLFFFAFFWAFFHSSLAPTSDLGVCWPPSGVSPLDPFLVPLLNTAVLLSSGVTVTWSHHSILENNWVDAVQ 160
84488826   81 GMVLFITSEVLFFFAFFWAFFHSSLAPVAELGVCWPPSGIEPLNPFLVPLLNTAVLLCSGVTITWSHHSIIENNMFNAVQ 160
188039033  81 GMILFITSEVLFFFAFFWAFFHSSLAPSVELGVCWPPSGITTLDPFLVPLLNTAVLLSSGVTITWSHHSLIEKNWFSAVQ 160
188039020  85 GFILFVVSEIMFFFSFFWAFFHSALSPTAEIGMSWPPQGINSINPWGVPLLNTAVLLSSGASLTWSHHSLREGEGSEAWS 164
289183185  85 GFILFVLSEIMFFFSFFWAFFHSALSPTAEIGMSWPPTGINPIHPWGIPLLNTAILLSSGGSLTWSHHSLREGNGTETWN 164
289183156  85 GFILFILSEVMFFFSFFWAFFHSALSPTPEIGMTWPPTGITPIHPWGVPLLNTAILLSSGASLTWSHHSLRQRSGDDAWN 164
5835092   161 GLFLTVILGIYFTGLQAWEYYDSPFTIADSVYGSSFFVATGFHGLHVLIGTTFLFICFLRLITFhFSNNHHFGFEAAAWY 240
41057400  164 ALIITVLLGVWFTSLQAYEYWEAPFSIADSVYGSTFFVATGFHGLHVIIGTTFLLICLIRLSNAhFSNNHHVGFECAIWY 243
49147338  165 SLLITVLLGAWFTSLQAYEYWEASFTIADSVYGSVFFVATGFHGLHVIIGTTFLCICLLRLIQShYSLNHHVGYECAIWY 244
5835465   161 GLFFTVLLGLYFTGLQAWEYYDAPFTISDSVYGSTFFVATGFHGLHVMIGTTFLFICLIRLMVYhFSNLHHFGFEAAAWY 240
84488729  161 GLFFTVFLGVYFTLLQAWEYFDSPFTISDGVYGSTFFVATGFHGLHVIIGTTFLLVCFFRLVVYhFSNSHHFGFEAAAWY 240
84488826  161 GLFFTVLLGIYFTLLQAWEYYDAPFTISDGVYGSTFFVATGFHGLHVIIGTTFLSVCFFRLLGYhFSNYHHFGFEAAAWY 240
188039033 161 ALFFTVLLGFYFTILQAWEYYDAPFNISDSVYGCTFFVATGFHGLHVIIGTTFLFVCLIRMVFYhFSNSHHFGFEAAAWY 240
188039020 165 SLLITVLLGLWFTSLQAYEYWEASFTIADSVYGSVFFVATGFHGLHVIVGTTFLCICLLRLVRGhFSLNHHVGYECAIWY 244
289183185 165 ALLITILLGLWFTALQAFEYYEAPFTIADSVYGSTFFVATGFHGLHVIIGTSFLFICLIRLARAhFSTNHHVGFECAIWY 244
289183156 165 ALAVTILLGIWFTSLQAYEYWEASFTIADSVYGSTFFVATGFHGLHVIIGTAFLAVCLGRLTRAhFSVNHHVGFECAIWY 244
5835092   241 WHFVDVVWLFLYICICWWGS 260
41057400  244 WHFVDVVWIFLFICIYWWGG 263
49147338  245 WHFVDVVWIFLFICIYWWGG 264
5835465   241 WHFLDVVWLFLYISIYWWGS 260
84488729  241 WHFVDVVWLFLYVSIYWWGS 260
84488826  241 WHFVDVVWLFLYVSIYWWGS 260
188039033 241 WHFVDVVWLFLYISIYWWGS 260
188039020 245 WHFVDVVWIFLFICIYWWGG 264
289183185 245 WHFVDVVWIFLFICIYWWGG 264
289183156 245 WHFVDVVWIFLFVCIYWWGG 264
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap