Conserved Protein Domain Family
COX2

?
MTH00038: COX2 
cytochrome c oxidase subunit II; Provisional
Statistics
?
PSSM-Id: 177113
View PSSM: MTH00038
Aligned: 29 rows
Threshold Bit Score: 385.979
Threshold Setting Gi: 289183209
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49147335    1 MSHPLQLNFQDAASYVMGEFHHFHDYAMIFVVFITILITYGLILLLFSAPSHWKFTEKQQVELWWTISPSFILIALAIPS 80 
5835462     1 MATWLQLGFQDASSPLMEELIYFHDYILVVLVLITIIVFYGLFSLLFIVNTDRFFLDSQGVETVWTVVPAFILVFIAFPS 80 
41057397    1 MSTPLQLGFQDPASYIMKQFLWFHDYAMSFIIFITILVIYALMLLAIKLPSFWKLIEKQQIELWWTVSPSFILVALAVPS 80 
84488725    1 MATWLQFGFQDASSPLMEELSYFHDYILVILVLVTVLVFYGLFSLLFIFSTDRFFLENQGLETVWTVVPAIILVFVAFPS 80 
84488823    1 MATWLQLGFQDASSPLMEELIYFHDYILIVLVLITVVVFYGLFSLLFISFTDRFFLESQGLETVWTIVPAFILVFIAFPS 80 
188039030   1 MATWLQLGFQDASSPLMEELIYFHDYVLIILVLITIIVFYGLFSLLFIYSTNRFFLDSQIIETIWTVVPAFILVFIAFPS 80 
188039017   1 MSHPLQLNFQDAASYVMGEFHHFHDYAMIFVVFITILIIYGLTLLLFAAPTHWKFTEKQQVELWWTISPSFILIALAIPS 80 
289183153   1 MSTPLQLGFQDAASYIMGEFHQFHDYAMVFVVFITILILYGLGALSLSVPSFWKFTEKQQVELWWTISPSFILIALAVPS 80 
289183182   1 MSIPLQLGFQDPASYVMQQFHEFHDYAMIFIVFITILVFYALTLLASNSPTHWKFVEKQNIELWWTISPGAILIALAVPS 80 
49146277    1 MATWAQLGLQDASSPLMEELVYFHDYTLIILTLIIILVFYGLLTILSSSFTNRFFLEGQELETIWTVIPAIILIFIAFPS 80 
49147335   81 INLLYWMDEGTNPDVTIKTIGHQWYWTYEIWDNNRIEFDSYMIHLEDFQQeGLPRLLEVDNRLVLPYNTDIRVITYSTDV 160
5835462    81 LQLLYLIDEINDPCLTIKALGHQWYWSYEYTDYCNLDFDSYMVFTDDLTF-GSLRLLEVDNRVIVPSQNSIRVLVSSSDV 159
41057397   81 IKLLYWMDEGINPEVTVKSIGHQWYWTYEFWDQNRIEIDSYMVQTEDLTTsGLPRLLEVDNRLVLPLNTNIRVVTHSTDV 160
84488725   81 LQLLYLIDEINDPCLTVKALGHQWYWSYEYTDYCDLNFDSYMVVVEDLLS-GFPRLLEVDNRVVVPFQNPVRVLVSSSDV 159
84488823   81 LQLLYLIDEINDPCLTIKVIGHQWYWSYEYTDYCDLDFDSYMVSLSDLST-GFPRLLEVDNRVVVPVQNSVRVLVSSSDV 159
188039030  81 LQLLYLIDEVNDPCLTIKALGHQWYWSYEFTDYHSLDFDSYMISVDDMSY-GSLRLLEVDNRVIIPSHNSIRVLVSSSDV 159
188039017  81 INLLYWMDEGTNPDITVKTIGHQWYWTYEIWDNQRLEFDSYMVHLEDITQeGLPRLLEVDNRLVLPYNTDIRVITYSTDV 160
289183153  81 INLLYFMDEGTNPSVTVKTIGHQWYWTYEIWDNQRIEVDSYMVHLEDIAQeGLPRLLEVDNRLVLPVDTDIRVITSSTDV 160
289183182  81 ISLLYYMDEGPNPEVTIKTIGHQWYWTYEIWDNHRIEIDSYMLQLEDYTTpGLPRLLEVDNRLVLPFNTNIRIITSSTDV 160
49146277   81 LQILYLMDEVNTPYLTVKAIGHQWYWSYEYTDYNDIEFDSYMTPTEDLQN-GEPRLLEVDNRLILPYQNPIRALITSSDV 159
49147335  161 IHAWSVPQLGLKMDAVPGRLNQMFVKIDRPGIFYGQCSEICGANHSFMPIvVVESVNQNTFYNWCNEISES 231
5835462   160 LHSWAIPSLGIKMDAVPGRLNQVTFLCPRSGVFYGQCSEICGASHSFMPI-VIESIPFNTFENWVYNFINN 229
41057397  161 IHAWCVPSLGVKMDAVPGRLNQLYVNIERPGIFYGQCSEICGANHSFMPI-VVEAVPRNEFYNWCSTISSE 230
84488725  160 LHSWAVPSLGLKMDAVPGRLNQVTFLVPRSGIFYGQCSEICGANHSFMPI-VIESVPFGVFEQWVSWFSD- 228
84488823  160 LHSWAVPSLGVKMDAVPGRLNQLTFLSPRSGVFYGQCSEICGANHSFMPI-VIESVPFNVFENWVFSFVES 229
188039030 160 LHSWAVPSLGIKMDAVPGRLNQVTFMIPRSGLFYGQCSEICGSNHSFMPI-VLESVPFNIFETWVSNYIVD 229
188039017 161 IHAWSVPQLGLKMDAVPGRLNQMFVKIDRPGIFYGQCSEICGANHSFMPI-VVESVNQETFYNWCNDVIEA 230
289183153 161 IHAWCVPTLGLKMDAVPGRLNQMFVNISRPGVFYGQCSEICGANHSFMPI-VVESVNAPLFYNWCHETAE- 229
289183182 161 IHAWCVPVLGLKMDAVPGRLNQMFTFIERTGVFYGQCSEICGSNHSFMPI-VVEAVNKETFYNWCNEMTE- 229
49146277  160 IHSWAVPSLGIKMDAIPGRLNQTSFLINRTGLFYGQCSEICGANHSFMPI-VIESVPFDSFQTWISNNIEE 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap