Conserved Protein Domain Family
COX1

?
MTH00037: COX1 
cytochrome c oxidase subunit I; Provisional
Statistics
?
PSSM-Id: 177112
View PSSM: MTH00037
Aligned: 29 rows
Threshold Bit Score: 842.184
Threshold Setting Gi: 289183207
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
49147333   10 LYISRWFFSTNHKDIGTLYLIFGAWAGTVGTAMSNIIRVELSQPGSLIQNDQTYNVIVTAHAFIMIFFMVMPIMIGGFGN 89 
5835460     1 MQLSRWLFSTNHKDIGTLYFLFGAWAGMVGTALSIIIRTELSQPGSFLGDDQIYNVIVTSHALIMIFFMVMPIMIGGFGN 80 
84488821    1 MQLSRWFFSTNHKDIGTLYFLFGSWAGMVGTALSIIIRAELAQPGSFLGDDQIYNVIVTSHALVMIFFMVMPVMIGGFGN 80 
84488724    1 MQLSRWLFSTNHKDIGTLYFLFGAWAGLVGTALSIIIRTELAQPGSFLGDDHIYNVVVTSHALIMIFFMVMPIMIGGFGN 80 
188039029   1 MQISRWFFSTNHKDIGTLYFLFGAWAGMLGTALSIIIRMELAQPGSFLGDDQIYNVVVTSHALIMIFFMVMPIMIGGFGN 80 
188039015  10 LYISRWFFSTNHKDIGTLYLIFGAWAGTVGTAMSNIIRVELSQPGSLIQNDQTYNVIVTAHAFIMIFFMVMPIMIGGFGN 89 
289183207   8 NYINRWLFSTNHKDIGTLYLIFGSWAGTVGTAMSNIIRVELSQPGSLIQNDQIYNVMVTSHALIMIFFMVMPIMIGGFGN 87 
289183151   8 NYISRWLFSTNHKDIGTLYLIFGAWAGTVGTAMSNIIRVELSQPGSLIQDDQLYNVMVTAHAFVMIFFMVMPIMIGGFGN 87 
289183180   9 NYIARWLFSTNHKDIGTLYLIFGAWAGTIGTAMSNIIRVELSQPGSLIQDDQVYNVMVTAHAFVMIFFMVMPIMIGGFGN 88 
304322867   1 MNLSRWLFSTNHKDIGTLYLIFGAWAGMVGTAMSVIIRTELAQPGSLLQDDQIYNVVVTAHALVMIFFMVMPIMIGGFGN 80 
49147333   90 WLVPLMIGAPDMAFPRMNNMSFWLIPPSFLLLIASAGNESGVGTGWTVYPPLSGPVAHAGGCVDLAIFSLHLAGASSIMA 169
5835460    81 WLIPLMIGAPDLAFPRVNNMSFWLLPPSFLLLLASAGVESGAGTGWTIYPPLSSGLAHSGGSVDLAIFSLHIAGASSIVA 160
84488821   81 WLIPLMIGAPDLAFPRVNNMSFWLLPPSFLLLLASAGVESGVGTGWTIYPPLSSGIAHAGGSVDFAIFSLHIAGASSIIA 160
84488724   81 WLIPLMIGAPDLAFPRVNNMSFWLLPPSFVLLLASAGVESGVGTGWTIYPPLSSGLAHAGGSVDLAIFSLHIAGASSIVA 160
188039029  81 WLIPLMIGAPDLAFPRVNNMSFWLLPPSFLLLLASAGVESGVGTGWTIYPPLSSGLAHAGGSVDLAIFSLHIAGASSIIA 160
188039015  90 WLVPLMIGAPDMAFPRMNNMSFWLIPPSFLLLVASAGNESGVGTGWTVYPPLSGPVAHAGGCVDLAIFSLHLAGASSIMA 169
289183207  88 WLVPLMIGAPDMAFPRMNNMSFWLIPPSFLLLLASAGNESGVGTGWTLYPPLSGPTAHGGGCVDLAIFSLHLAGASSIMA 167
289183151  88 WLVPLMIGAPDMAFPRMNNMSFWLVPPAFLLLMASAGNESGVGTGWTAYPPLSGPVAHAGGCVDLAIFSLHLAGASSIMA 167
289183180  89 WLVPLMIGAPDMAFPRMNNMSFWLIPPAFMLLLTSAGNESGVGTGWTVYPPLSGPVAHGGGCVDLAIFSLHLAGASSIMA 168
304322867  81 WLIPLMIGAPDMAFPRMNNMSFWLVPPSFILLLASAGVESGVGTGWTIYPPLSSNIAHAGGSVDLAIFSLHLAGASSILA 160
49147333  170 SINFITTIINMRAPGMSMDRTPLFVWSILITTFLLLLSLPVLAGAITMLLTDRNINTSFFDPTGGGDPILFQHLFWFFGH 249
5835460   161 SINFITTVINMRSPGVTFDRLPLFVWSAFITAFLLLLSLPVLAGAITMLLTDRNINTTFFDPAGGGDPILFQHLFWFFGH 240
84488821  161 SINFITTIINMRAPGVTFDRLSLFVWSIFITTFLLLLSLPVLAGAITMLLTDRNVNTTFFDPAGGGDPILFQHLFWFFGH 240
84488724  161 SINFITTIINMRSPGVTFDRLPLFVWSVFITTFLLLLALPVLAGAITMLLTDRNVNTTFFDPAGGGDPILFQHLFWFFGH 240
188039029 161 SINFITTVINMRSPGVTFDRLPLFVWSAFITAFLLLLSLPVLAGAITMLLTDRNVNTTFFDPAGGGDPILFQHLFWFFGH 240
188039015 170 SINFITTIINMRAPGMTMDRTPLFVWSILITTFLLLLSLPVLAGAITMLLTDRNINTSFFDPTGGGDPILFQHLFWFFGH 249
289183207 168 SINFISTIINMRAPGMTLDRTPLFVWSILITTFLLLLSLPVLAGAITMLLTDRNINTTFFDPTGGGDPILFQHLFWFFGH 247
289183151 168 SINFITTIINMRSPGMTMDRVPLFVWSILITTVLLLLSLPVLAGAITMLLTDRNINTTFFDPTGGGDPILFQHLFWFFGH 247
289183180 169 SINFITTIINMRAPGMSMDRTPLFVWSILLTTILLLLSLPVLAGAITMLLTDRNINTSFFDPTGGGDPVLYQHLFWFFGH 248
304322867 161 SINFITTIINMRTPGVTFDRLPLFVWSVFITAFLLLLSLPVLAGAITMLLTDRNINTTFFDPAGGGDPILFQHLFWFFGH 240
49147333  250 PEVYILILPGFGIISHVVTNRTGSNNPFGYLGMMYAMIAIGILGFIVWAHHMFTVGLDVDTRAYFTAATMIIAIPTGVKV 329
5835460   241 PEVYILILPGFGMISHVVAHYSGKQEPFGYLGMVYAMVAIGILGFLVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKV 320
84488821  241 PEVYILILPGFGMISHVVSHYSGKSEPFGYLGMVYAMVAIGILGFLVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKV 320
84488724  241 PEVYILILPGFGMISHVVAHYSGKSEPFGYLGMVYAMVAIGVLGFLVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKV 320
188039029 241 PEVYILILPGFGIISHVVAHYSGKKEPFGYLGMVYAMVAIGVLGFLVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKV 320
188039015 250 PEVYILILPGFGIISHVVTNRTGKQQPFGYLGMMYAMITIGILGFIVWAHHMFTVGLDVDTRAYFTAATMIIAIPTGVKV 329
289183207 248 PEVYILILPGFGIISHVVTNRTGKNQPFGYLGMMYAMIAIGILGFIVWAHHMFTVGLDVDTRAYFTAATMIIAIPTGVKV 327
289183151 248 PEVYILILPGFGIISHIVTSRTGKQQPFGYLGMMYAMIAIGILGFIVWAHHMFTVGLDVDTRAYFTAATMIIAIPTGVKV 327
289183180 249 PEVYILILPGFGIISHVVTSRTGKQQPFGYLGMMYAMISIGILGFIVWAHHMFTVGLDVDTRAYFTAATMIIAIPTGVKV 328
304322867 241 PEVYILILPGFGMISHVIAHYSGKQEPFGYLGMVYAMVAIGILGFLVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKV 320
49147333  330 FSWLATLQGVPFNINnahPSLLWAIGFIFLFTVGGLTGIVLSNSSLNVALHDTYYVTAHFHYVLSMGAVFAIFSGFNHWF 409
5835460   321 FSWMATLQGSNIRWD---VPLFWALGFIFLFTLGGLTGVVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAIFSGFTHWF 397
84488821  321 FSWMATLQGSSLRWE---APLFWALGFIFLFTLGGLTGVVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAIFSGFTHWF 397
84488724  321 FSWMATLQGSNLRWD---APLLWALGFIFLFTVGGLTGVVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAIFSGFVHWF 397
188039029 321 FSWMATLQGSNISWD---APLLWALGFIFLFTLGGLTGVVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAIFSGFTHWF 397
188039015 330 FSWLATLQGVPFNINnahPSLMWAIGFIFLFTVGGLTGIVLSNSSLNVALHDTYYVTAHFHYVLSMGAVFAIFSGFNHWF 409
289183207 328 FSWLATLQGTSLTINkihPSLMWALGFIFLFTIGGLTGIILSNSSLNIALHDTYYVTAHFHYVLSMGAVFAIFSGFNHWF 407
289183151 328 FSWLATLQGVPFYINkahPSLLWALGFIFLFTVGGLTGIVLSNSSLNVALHDTYYVTAHFHYVLSMGAVFAIFAGFNHWF 407
289183180 329 FSWLATLQGVSFFSNkthPSVMWALGFIFLFTIGGLTGIILSNSSLDVALHDTYYVTAHFHYVLSMGAVFAIFAGFNHWF 408
304322867 321 FSWMATLQGSKLVWE---TPLLWALGFVFLFTVGGLTGIVLANSSIDVILHDTYYVVAHFHYVLSMGAVFAIFSGFTHWF 397
49147333  410 PLLQGAQLDNTSATTHFILMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAFAFWNTVSSLGSLLSFIGTIGFLTIVALSLN 489
5835460   398 PLFSGVGFHPQLSKVQFFIMFIGVNLTFFPQHFLGLAGMPRRYADYPDAYVSWNLVSSIGSIISLVAVIFFIFLVWEAFV 477
84488821  398 PLFSGVGFHPQLSKVQFVIMFIGVNLTFFPQHFLGLAGMPRRYADYPDAYTSWNMVSSIGSVISLVAVIFFMFLVWESFV 477
84488724  398 PLFSGVSLHAQLAKVHFFLMFIGVNLTFFPQHFLGLAGMPRRYADYPDVYTSWNVVSSIGSVISFVAVIFFIFLVWEAFV 477
188039029 398 SLFSGVGLHPQLSKIQFFLMFIGVNLTFFPQHFLGLAGMPRRYADYPDAYMSWNLVSSIGSVISLIAVVFFMFLVWEAFI 477
188039015 410 PLFTGANLDHTSATTHFILMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAFTFWNTVSSLGSLLSFIGTIGFLTIVALSLS 489
289183207 408 SLFTGCHLDETGATTHFILMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAFTFWNTLSSLGSLLSFISTIGFLTIVILSLN 487
289183151 408 SLFTGAQLDQTSATAHFILMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAFAFWNTVSSLGSLLSFIATIGFLTIVTLSFT 487
289183180 409 QLFTGAHLDHTSATAHFFIMFLGVNLTFFPQHFLGLAGMPRRYSDYPDAFTFWNTVSSFGSLLSFIGTIGFLTIVILSIF 488
304322867 398 PLFSGTALHPLWSKVQFFIMFIGVNLTFFPQHFLGLAGMPRRYSDYPDAYTTWNTVSSIGSIISLVGALFFLFLIWEAFA 477
49147333  490 NTNTNTSTNEITTNLEWFYPSYPPQEHTFNEMPTSWKSIN 529
5835460   478 VRRSVLLPSYVSSSLEWQYSFFPPSHHTYNETPFVVLINS 517
84488821  478 VRREVISPDYSFSSLEWQYSFFPPSHHTFDETPFVVVIRS 517
84488724  478 VRREVVSPGFSSSFLEWQYSSFPPGHHTYDETPFVVMVSS 517
188039029 478 VRRVVISPDFSSSSLEWQYNFFPPSHHTYEETPFVVIINL 517
188039015 490 NNNINTSTNEAISNLEWHYPIYPPQEHTFNEMPISWNSIN 529
289183207 488 NTNNNYFNNEISNNLEWHYPLFPPQEHTFNETPLSIINTN 527
289183151 488 TNSVNTHTNDSISNLEWHYPNFPPQEHTFNEMPIGAGTAK 527
289183180 489 SKNENTHTNEIATSLEWHYPEFPPQEHTFNETPTGHKSPI 528
304322867 478 SQRPVPAPSFVPASLEWQYESFPPSHHTFEETPTTFLPIK 517
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap