Conserved Protein Domain Family
ATP6

?
MTH00035: ATP6 
ATP synthase F0 subunit 6; Validated
Statistics
?
PSSM-Id: 177110
View PSSM: MTH00035
Aligned: 29 rows
Threshold Bit Score: 230.245
Threshold Setting Gi: 289183211
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5834974     3 MTI-TVSIFGQFFPETLLFIPMNLFSIVFALSWIAFIYPTNWAPSRFQSIWASFRANVLEMIFQNT-SPNTAPWAGLITT 80 
84488727    1 MVI-F-SIFDQFQSSVFFIVPMIFLCLSLNVVWSFFLVSESWSKSRFFVFWSGFVGLALKLIFQTT-SVKTGPWASVLFT 77 
41057399    1 MTL-INNIFDQFNPAYVGPLSLTSLGACFAISWTAYLTTTHWTPTRSGILKNSISAALLNLLPQSM----NSSWTLMLAP 75 
5835464     1 MVI-FNSIFDQFYPDTFFFFPISILCLLINVFWCFFMISESWLCGRCQVFWLNFIFSSIGLIFANYfSVVQTSWGGLLVT 79 
49147337    6 IFI-INNIFDQFIPVKLSIFSLTSVGSIIALSWVWINTKTHWAISRSNTP-SLLLNSLWTLLITNL-NEKTNPWAPWLFS 82 
84488825    1 MVI-FFSIFDQFYPDTFLLIPISLLCFFINIIWFFFMVNNTWLRCRCQVFWYNFISFSVGLIFQTT-SRGTASWGGLLIT 78 
188039019   3 MII-INNIFDQFIPVKISIFSLTFIGSTIALSWIWLNTKTHWIISRSNSP-LIFLNSLWTLLLTNI-NNKTNPWANWLFS 79 
188039032   1 MII-FSSIFDQFYPDSLFFIPVSFLCLLINISWCFFLISNSWFLGRYQVFWLNFVNTSLGLIFQTT-SRGTSPWGGLLIT 78 
289183211   3 LIIpLHNIFNQFIPTNIFFFPLSIIGSSIALLWILLSNNTHWIQNRNNSI-----NIIKNNLFNEFlNTNNNNWNTNLFS 77 
289183155   3 III--NNIFSQFNPTTILSVPLTVLGAIIAITWFTLITKTHWLNTRSDLL-PLFSQLTFKSLLNDQ-TGKPAKWTPILFT 78 
5834974    81 VFIVILSANVLGLFPYAFTATSHISLTYSLGFPIWMAVNILGFYLAFNSRLSHLVPQGTPSALIPLMVWIETLSLFAQPI 160
84488727   78 VFVFILSINVMGLFPYLFTSTSHVSITFSIGFPLWLGVNVLGFYFSFGSRLSHLVPQGTPIILIPLMVWIETLSLFAQPL 157
41057399   76 VFIVCLSYNILSLIPYTFSQTSHLSITFSLSIPLWMGINLMGLWHNWQGKISHLVPQGTPAALIPLMVMIELMSLIIQPL 155
5835464    80 VFVFILSINLLGLLPYNFTSTSHFSITFSLGFPLWLSVNIFGFYSSFNSRLSHLVPQGTPFVLIPLMVWIETLSFFAQPL 159
49147337   83 LFLLCFSFNIMSLIPYTFSQTSHLSFTFGLSLPIWIMVNIAGFKNNWKKKISHLLPQGTPIYLVPVMIIIETISLFIQPL 162
84488825   79 VFVFLLSINLLGLLPYNFTNTSHVSITFSLGFPFWLSVNIFGFYSSFKGRLSHLVPQGTPAILIPLMVWIETLSLFAQPL 158
188039019  80 LFLICLSFNVMSLIPYTFSQTSHLSFTFGLSLPIWLMVNIAGFKDNWKNKVSHLLPQGTPIYLVPVMIIIETISLCIQPL 159
188039032  79 IFIFILSINLLGLFPYNFTNTSHISITFSLGFPLWFGVNIFGFYSSFNVRLSHFVPQGTPFILIPLMVWIETLSFFAQPL 158
289183211  78 LFLIILSFNILSLIPYTFSQTSHLSITFSMSIPIWLLIQTTGIKNNLKNKTSHLLPNNTPTPLIPFMIIIETISLLIQPL 157
289183155  79 VFILCLSYNLLSLIPYTFSQTSHLSVTFSLSLPIWVAFQVAGAGHDWKAKLSHLLPQGTPIFLIPPMILIETISLIIQPL 158
5834974   161 ALGLRLAANLTAGHLLIFLLSTAIWLLSSSLMVsSIPIFVIFVLLFILEIGVACIEAYVFTALVHFYLQQNV 232
84488727  158 ALGLRLAANLTAGHLLIFLLVSTVWAFVDVFCV-FVPLVGLFFLLLILEIAVACIQAYVFTALVHFYLQENF 228
41057399  156 TLGFRLGANLLAGHLLIFLCSCVVWEAINTSPL-GTISILLLLALFILEIAVACIQAAVFTVLAKNYFEENF 226
5835464   160 ALGLRLAANLTAGHLLIFLLATTIWSFINTYFI-FFPLLIVFFLLFILEIAVAVIQAYVFTALIHFYLQENL 230
49147337  163 TLGFRLGANLLAGHLLIFLCSCTIWEAINYNIYlGTISFSLILVLLILEIAVAFIQATVFLILSKNYLEENI 234
84488825  159 ALGLRLAANLTAGHLLIFLLATTVWTFVNSYYF-FFPLIFIFFLLFILEIAVACIQAYVFTTLIHFYLQENL 229
188039019 160 TLGFRLGANLLAGHLLIFLCSCTIAEAINYNLYlGIISFSLILVLLILEIAVAFIQATVFLILSKNYLEENI 231
188039032 159 ALGLRLAANLTAGHLLIFLLSTTIWSFINVYYV-FFPLCFVFLLLFILEIAVACIQAYVFVALIHFYLQENL 229
289183211 158 TLGFRLGANLLAGHLLIFLCSCTIWEISNTHPL-GIITISLIFLLLTLEIAVACIQATVFLILSKSYLEENI 228
289183155 159 TLGFRLGANLLAGHLLIFLCSCTIWEAINASLA-GLMSFILIIVLLILEIAVACIQAAVFLILSKNYLEENL 229
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap