Conserved Protein Domain Family
CYTB

?
MTH00034: CYTB 
cytochrome b; Validated
Statistics
?
PSSM-Id: 177109
View PSSM: MTH00034
Aligned: 29 rows
Threshold Bit Score: 634.822
Threshold Setting Gi: 84488721
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
159106777   1 MSAIRKNHPVVKILNSSLWDLPTPSNLSVWWNFGSLIGLCLGAQIVTGIFLAMHYTADTTLAFSSVAHICRDVNYGWLLR 80 
84488818    2 VGPIRKSHPILKVINSTFITLPCPSNFFIWWNFGSLLGLCLIIQLISGLFLSMHYTADVSLAFSSVSHICRDVNYGWLLR 81 
84488721    2 VGPIRKSHPLLAIVNSTFITLPCPGNFFVWWNFGSLLGLCLIVQILTGLFLSMHYIADISMAFSSVSHICRDVSYGWLLR 81 
49147345    2 NVPLRKNHPVIKIVNNSLWDLPTPSNLSAWWNFGSLIGLCLGIQIITGIFLAMHYTADITIAFSSVSHICRDVNYGWLLR 81 
28916748    2 TGPLRKTHPLFKIINGSLIDLPSPSNLSIWWNFGSLLGLCLIVQILTGLFLAMHYTSDISLAFSSVSHICRDVNYGWLLR 81 
5835457     2 VGPIRKSHPLLKIINSTFISLPCPSNFFIWWNFGSLLGLCLIIQLITGIFLAMHYTADISLAFSSVGHICRDVNYGWLLR 81 
188039027   2 NNAIRKNHPIIKIINSSLWDLPTPSNLSAWWNFGSLIGLCLGVQIITGIFLAMHFTADISLAFSSVSHICRDVNYGWLLR 81 
188039039   2 VGPIRKNHSILNIINSTFITLPCPSNFFIWWNFGSLLGLCLVIQLLTGIFLSMHYTADISLAFSSVSHICRDVSYGWLLR 81 
289183148   2 LSPLRKRHPVLSIINGALWDLPSPSNISAWWNFGSLIGLCLITQIITGIFLAMHYTADTTMAFSSVSHICRDVNYGWLLR 81 
289183177   2 FLPLRKRHPIVSILNSSLWDLPSPSNLSIWWNFGSLIGLCLGVQIITGIFLAMHFTADTEMAFSSVAHICRDVNYGWLLR 81 
159106777  81 NVHANGASLFFICVYIHIGRSLYYGSYVNMITWNIGVVLFLLSILNCFFGYVLPWGQMSFWAATVITNLVTAVPYIGGDI 160
84488818   82 NIHANGASLFFVCLYVHIGRGLYYGSYKNFETWNVGVLLLFLVMGTAFVGYVLPWGQMSFWGATVITNLLSAIPYFGVYL 161
84488721   82 SIHANGASLFFICLYFHIGRGLYYGSYVNTEVWNVGVLLFICVMITAFVGYVLPWGQMSFWGATVITSLFSAVPYLGSSL 161
49147345   82 NIHANGGSMFFICIYFHMGRGLYYGSYINQMTWNIGVILFLLSILTAFFGYVLPWGQMTFWAATVITNLVTAIPYIGNDI 161
28916748   82 NTHANTASFFFICMYFHIGRGIYYGSYVNNETWNIGVILFLLTMLTAFVGYVLPWGQMSFWGATVITNLVSALPYIGTTI 161
5835457    82 NIHANGASLFFICLYIHIGRGLYYGSYVNFETWNVGVLLLFLVMATAFVGYVLPWGQMSFGGATVITNLLSAIPYLGVFL 161
188039027  82 NIHANGGSMFFICIYFHMGRGLYYGSYINQMTWNIGVVLFLLSILTAFFGYVLPWGQMSFWAATVITNLVTAVPYIGNDI 161
188039039  82 NIHANGASLFFICLYIHIGRGIYYGSYLNIEVWNVGVLLLFMVMGTAFVGYVLPWGQMSFWGATVITNLLSAIPYLGVFL 161
289183148  82 SIHANGGSMFFICIYFHIGRGLYYGSYVNAITWNIGVVLFLLSILTAFFGYVLPWGQMSFWAATVITNLVTAIPYIGTDI 161
289183177  82 NIHANGASLFFICIYFHIGRGLYYGSYVNNMTWNIGVVLFLLSILTAFFGYVLPWGQMSFWAATVITNLVTAVPYVGTDI 161
159106777 161 VQWIWGGFSVDNATLHRFFVFHFLFPFILAFLSDLHLLFLHETGSNNPLGLPSDCDKTPFHVYFTSKDVVGFGFFFVGLI 240
84488818  162 VQWVWGGFSVDNATLVRFFAFHFLLPFVIVAFSVIHLLFLHQSGSNNPTGINSNSDKVPFHVYYTIKDFLWFLVVITFLC 241
84488721  162 VQWIWGGFSVDSATLTRFFAFHFLFPFIVAALSAVHLLFLHDTGSNNPTGLESNFDKIPFHSYYTIKDILWFLAVFFIFG 241
49147345  162 VQWIWGGFSVDNPTLHRFFVFHFLFPFILAFLSILHLLFLHETGSNNPLGIPSDYDKVSFHTYFSSKDLVGFTIFILALS 241
28916748  162 VQWIWGGFSVDNATLTRFFAFHFLFPFIITALAIVHLLFLHQTGSNNPTGIESTFDKTPFHTYFSTKDLTGFIIMFIALS 241
5835457   162 VQWVWGGFSVDNATLVRFFTFHFLLPFIIIALSVVHLLFLHQTGSNNPTGLDSSSDKVPFHIYYTVKDILWFLIIISFLG 241
188039027 162 VQWIWGGFSVDNPTLHRFFVFHFLFPFVLAFLSILHLLFLHETGSNNPLGIPSDYDKVTFHTYFSSKDLVGFIIFFIALG 241
188039039 162 VQWVWGGFSVDNATLIRFFTFHFLLPFIIVALSAIHLLFLHQNGSNNPTGLDSNSDKVPFHIYYTVKDFLWFFLILGFLS 241
289183148 162 VQWIWGGFSVDNPTLHRFFVFHFLFPFILAFLSILHLLFLHETGSNNPLGIPSDYDKVSFHTFFTSKDVVGFVLFFVIFS 241
289183177 162 VQWIWGGFSVENPTLHRFFVFHFLFPFILTFLSILHILFLHETGSNNPLGVPSDYDKVPFHTYYTSKDTAGFMIFFGFLA 241
159106777 241 ILSLLFPTALSDPENYIPANPLVTPPHIQPEWYFLCSYAILRSIPNKLGGRAALVSSILALFLIPVLHLSDQNACFSRPL 320
84488818  242 FVAFFFPTVLNDPDNFVCANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVLALLGAILILFFVPLFHTSSQQSKIFCPL 321
84488721  242 FVVLFFPGLLIDPENFIPANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVLALVGSIAILFLVPFIHVSNQQASFFRPL 321
49147345  242 TLTLIYPTSLSDPENFIPANPLVTPPHIQPEWYFLFAYAILRSIPNKLGGVVALVGAILVLFLVPITHLAPQNSNSYRPL 321
28916748  242 SIVLLSPTLLNDPENFNPANPLVTPLHIQPEWYFLFAYAILRSIPNKLGGVLALLASILVLFLVPILHTSNNQANTFRPA 321
5835457   242 FIALFFPNAFNDPDNFIPANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVLALGGAIAILFLVPLLHTSNQQSSVFRPF 321
188039027 242 SLALLYPTSLSDPENFIPANPLVTPPHIQPEWYFLFAYAILRSIPNKLGGVIALVSAILVLFLVPILHLSPQNSSSHRPL 321
188039039 242 LIVLFFPNAFTDPENFIPANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVLALAGAIAVLFFIPFLHLSEQRSSIFRPF 321
289183148 242 WLALLYPTALSDPENFIPANPLVTPPHIQPEWYFLFVYAILRSIPNKLGGVIALVGAVAVLFLVPILHFSSQNSCCYRPF 321
289183177 242 LLALLYPTALSDPENFIPANPLVTPPHIQPEWYFLFAYAILRSIPNKLGGVIALVMAILVLFLIPLMHFSSQNACCFRPI 321
159106777 321 GQIAFWLIIGNFFLLTWIGSQPVEYPYIVLGQLASVFYFVGFLGLNPLISYSEKLFEAD 379
84488818  322 SQFVFWCLISCFFILTWLGGQPVESPYIELGQVASIFYFSIFLFWMPFVSYLENLFIFN 380
84488721  322 SQFVFWALIVCFWALTWLGGQPVETPYIELGQAVSVFYFSLFLFWLPFTSYLENLLFIE 380
49147345  322 SQIAFWLFIGDFFILTWIGSQPVEYPFIVLGQLASVYYFINFLIIMPLIGAFEKEMWNN 380
28916748  322 SQSFFWILISVFIILTWIGSQPVEEPFIILGQISSILYFMLFILFIPITAQIENNLIF- 379
5835457   322 SQLNFWCLIVCFFLLTWLGGQPVETPYIELSQVVSFFYFSIFFIFFPLISYLENFFIFN 380
188039027 322 SQVFFWLFVGDFFILTWIGSQPVEYPFIILGQLASVYYFLNFLVFLPLIGFLEKNMWNS 380
188039039 322 SQFIFWCLIVCFFLLTWLGGQPVESPYIELGQVSSILYFSLFFFLFPFVSYIENFFIFN 380
289183148 322 GQIFFWLVVGDFFILTWIGSQPVEFPFILLGQLASLFYFLCFLVFIPAVSIGEKKFCNS 380
289183177 322 SQILFWLVVGNFIILTWIGSQPVEEPFILLGQLASIFYFLSFLYLLPLGGLIEKEVCSS 380
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap