Conserved Protein Domain Family
CYTB

?
MTH00033: CYTB 
cytochrome b; Provisional
Statistics
?
PSSM-Id: 133672
View PSSM: MTH00033
Aligned: 4 rows
Threshold Bit Score: 640.447
Threshold Setting Gi: 124359005
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124359022   1 MRLRKTGLLAPVNDIIDLPTPSNISYWWNFGSLLSLCLGIQILTGVLLAMHYRSDVSLAFSSVAHIVRDVNYGWILRYVH 80 
124358991   1 MRLRKTGLLEPVNGIIDLPTPSNISYWWNFGSLLCLCLGIQILTGVLLAMHYRSDVSLAFSSVAHIVRDVNYGWILRYVH 80 
124359005   1 MRLRKTGLLEPVNDIIDLPTPSNISYWWNFGSLLCLCLGIQIITGVLLAMHYRSDVSLAFSSVAHIVRDVNYGWILRYVH 80 
108860654   1 MRLRKTGLLAPVNDIIDLPTPSNISYWWNFGSLLGLCLGIQILTGVLLAMHYRSDVSLAFSSVAHIVRDVNYGWILRYVH 80 
124359022  81 ANGASLFFICVYCHIGRGLYYGGYSRVLTWIVGVLIYFIMMLTAFIGYVLPWGQMSFWGATVITNLVSALPSVGGSIVEW 160
124358991  81 ANGASLFFICVYCHIGRGLYYGGYSRVLTWIVGVLIFFIMMLTAFIGYVLPWGQMSFWAATVITNLVSALPSVGSSIVEW 160
124359005  81 ANGASLFFICVYCHIGRGLYYGGYSRILTWIVGVFIFFIMMLTAFIGYVLPWGQMSFWAATVITNLVSAIPSVGGSIVEW 160
108860654  81 ANGASLFFICVYCHIGRGLYYGSYSRVLTWIVGVLIYFIMMLTAFIGYVLPWGQMSFWGATVITNLVSAIPSVGGSIVEW 160
124359022 161 IWGGFSVSNCTLNRFFSLHYLLPFVLVGLVLAHLLTLHEKGSNNPLGVVSFSDRSPFHVYFTIKDILGFLILFGVFVIIG 240
124358991 161 IWGGFSVSNCTLNRFFSLHYLLPFVLVGLVLAHLLTLHEKGSNEPLGLVGLSDRTAFHVYFTIKDILGFLILFLILVIIG 240
124359005 161 IWGGFSVSNCTLNRFFSLHYLLPFVLVGLVLAHLLTLHEKGSNEPLGLVGLSDRTAFHVYFTIKDILGFLFLFFLFVIIG 240
108860654 161 IWGGFSVSNCTLNRFFSLHYLLPFVLVGLVLAHLLTLHEKGANNPLGVVSLSDRSTFHVYFTIKDILGFLILLGVFVIIG 240
124359022 241 IEPRIEELLQDPENFIQANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVLALFASILVLLFLPILDRSAplgPRSLTFN 320
124358991 241 IEPRIETLLQDPENFIQANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVLALFASILVLLLMPILDRSK---IRSLTFN 317
124359005 241 IEPRIETLLQDPENYIQANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVLALFASILVLLLMPILDCSK---IRSLTFN 317
108860654 241 IEPRIETLLQDPENFIQANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVLALFASILVLLLMPILDRSK---IRSLTFN 317
124359022 321 PVAKFFFWFIVGDFFILTWIGSAPAGTEPYVLIGRIATIFYFGYFLVLVPLLGYLSNLFYEYNGTT 386
124358991 318 PTGKFFFWFIVGDFIILTWIGSAPAGADPYVLIGRIATIFYFGYFLVLVPLLGYLSNLFYEYNGTS 383
124359005 318 PTGKFFFWFFVGDFIILTWIGSAPAGADPYVLIGRIATIFYFGYFLVLVPLLGYLSNSFYEHNAGR 383
108860654 318 PVAKFFFWFIVGDFFILTWIGSAPAGTEPYVLIGRIATIFYFGYFLVLVPLLGYLSNLFYEYNGTT 383
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap