Conserved Protein Domain Family
ND3

?
MTH00030: ND3 
NADH dehydrogenase subunit 3; Provisional
Statistics
?
PSSM-Id: 164603
View PSSM: MTH00030
Aligned: 4 rows
Threshold Bit Score: 178.203
Threshold Setting Gi: 124359012
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124359012   1 MNPEFKTIFFSALLALCIILLLISISFTLGNSRIGLTKPDSEKSSIYECGFDPFGKIRTPFTIKFVLVGILFMIFDIEIS 80 
124358998   1 MNPEFKTIFFSTLLGVSIILLLVFISFTLGNSRIGLTKPDSEKSSIYECGFDPFGKIRTPFTIKFVLVGILFMIFDIEIS 80 
108860658   1 MNPEFKTIFYSTLLGVGIILLLVSISFALGNSRIGSTRPDSEKSSIYECGFDPFGKIRTPFAIKFVLVGILFMIFDIEVS 80 
124359024   1 MNPEFKTIFYSTLLGVGIILLLVSISFALGNSRIGFTKPDSEKSSIYECGFDPFGKIRTPFAIKFVLVGILFMIFDIEVS 80 
124359012  81 FLFPWSIVFNQLNLFSFWIVYTFLIVLAIGLAYEWIKGGLEWD 123
124358998  81 FLFPWSIVFNQLNLFSFWIVYTFLIVLTIGLAYEWIKGGLEWD 123
108860658  81 FLFPWSIVFNQLNLFSFWVVYTFLVILSLGLAYEWLKGGLEWD 123
124359024  81 FLFPWSIVFNQLNLFSFWVVYTFLVILALGLAYEWLKGGLEWD 123
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap