Conserved Protein Domain Family
ND1

?
MTH00029: ND1 
NADH dehydrogenase subunit 1; Provisional
Statistics
?
PSSM-Id: 177108
View PSSM: MTH00029
Aligned: 4 rows
Threshold Bit Score: 563.872
Threshold Setting Gi: 124359030
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124359007   1 MTIYSYITVTIKLLIIFVPLLLSVAYLTLAERKVLGLMQNRKGPAIVGPWGLVQPIADGVKLLTKELVIPSQANKFLYYI 80 
124358993   1 MTIYSYITVTIKLLIIFVPLLLSVAYLTLAERKVLGLMQNRKGPAIVGPWGLVQPIADGVKLLTKELIIPSQANKFLYYI 80 
108860657   1 MTINSYITVTIKLLIIFVPLLLSVAYLTLAERKVLGLMQNRKGPAIVGPWGLVQPIADGVKLLTKELIIPSQANKFMYYI 80 
124359030   1 MTIISYITVTIKLIIIFVPLLLSVAYLTLAERKVLGLMQNRKGPAIVGPWGLVQPIADGVKLLTKELIIPSQANKFMYYI 80 
124359007  81 APIISFTLAILAWAIVTMDQGVFLSDLDVGVLYFLAISSLSVYAILLSGWASNSRYPFLGAIRCAAQMISYEVAIGLIII 160
124358993  81 APIISFTFAILAWAIVTMDQGVFLSDLDVGVLYFLAISSISVYAILLSGWASNSRYPFLGAIRCAAQMISYEVAIGLIII 160
108860657  81 APIISFTLAILAWAIVTMDQGVLLSDLDIGVLYFFAISSLSVYAILLSGWASNSRYPFLGAIRCAAQMISYEVAIGLIII 160
124359030  81 APIISFTLAILAWAIVTMDQGVFLSDLDIGVLYFFAISSLSVYAILLSGWASNSRYPFLGAIRCAAQMISYEVAIGLIII 160
124359007 161 SVILCVGSLNISEIVISQRSVWLIIPLFPAAIMFMVASLAETARAPFDLTEGESELVSGFNVEYSSLSFALFFLAEYSNI 240
124358993 161 SVILCVGSLNISEIVISQRSVWLIIPLFPAAIMFMVASLAETARAPFDLTEGESELVSGFNVEYSSLSFALFFLAEYSNI 240
108860657 161 SVILCVGSLNISEIVLSQKSVWLIIPLFPAAIMFMVASLAETARAPFDLTEGESELVSGFNVEYSSLSFALFFLAEYSNI 240
124359030 161 SVILCVGSLNISEIVISQKSVWLIIPLFPAAIMFMVASLAETARAPFDLTEGESELVSGFNVEYSSLSFALFFLAEYSNI 240
124359007 241 ILMSCMMTIFFLGGWLSPLDSIqwPEVFKIFGQGDPLDPVWLSFWFFTKSSIFILFFIWSRASFPRIRYDQLMKLLWKTY 320
124358993 241 ILMSCMMTIFFLGGWLPPFDGA--PTAPEAFSIFEQIAGSKGSLWFFTKSSIFILFFIWSRASFPRIRYDQLMKLLWKTY 318
108860657 241 ILMSCMMTIFFLGGWLSPLGDP--LDPIAWFLAPTGALSGGSAVWFFTKSSIFILFFLWSRASFPRIRYDQLMKLLWKTY 318
124359030 241 ILMSCMMTIFFLGGWLSPLYTIewWAP-----------SAPSAFWFFTKSSIFILFFLWSRASFPRIRYDQLMKLLWKTY 309
124359007 321 LPLSLGLVILTAGILIGFNGVPPPF 345
124358993 319 LPLSLGLVILTAGILIGFNGVPPPF 343
108860657 319 LPLSLGLVVLTAGILIGFNGVPPPY 343
124359030 310 LPLSLGLVVLTAGILIGFNGVPPPY 334
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap