Conserved Protein Domain Family
COX1

?
MTH00026: COX1 
cytochrome c oxidase subunit I; Provisional
Statistics
?
PSSM-Id: 164599
View PSSM: MTH00026
Aligned: 4 rows
Threshold Bit Score: 913.244
Threshold Setting Gi: 254032053
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
254032057   1 MTSFVRWFFSCNHKDIGSLYLVFGALSGAIGTAFSMLIRLELSSPGSMLGDDHLYNVIVTAHAFVMIFFLVMPTMIGGFG 80 
254032053   1 MTSFVRWFFSCNHKDIGSLYLIFGALSGAIGTAFSMLIRLELSSPGSMLGDDHLYNVIVTAHAFVMIFFLVMPTMIGGFG 80 
254032047   1 MTSFVRWFFSCNHKDIGSLYLVFGALSGAIGTAFSMLIRLELSSPGSMLGDDHLYNVIVTAHAFVMIFFLVMPTMIGGFG 80 
254032033   1 MTSFVRWFFSCNHKDIGSLYLVFGALSGAIGTAFSMLIRLELSSPGSMLGDDHLYNVIVTAHAFVMIFFLVMPTMIGGFG 80 
254032057  81 NWFVPLMIGAPDMAFPRLNNISFWLLPPALFLLLGSSLVEQGAGTGWTVYPPLASIQAHSGGSVDMAIFSLHLAGLSSIL 160
254032053  81 NWFVPLMIGAPDMAFPRLNNISFWLLPPALFLLLGSSLVEQGAGTGWTVYPPLASIQAHSGGSVDMAIFSLHLAGLSSIL 160
254032047  81 NWFVPLMIGAPDMAFPRLNNISFWLLPPALFLLLGSSLVEQGAGTGWTVYPPLASIQAHSGGSVDMAIFSLHLAGLSSIL 160
254032033  81 NWFVPLMIGAPDMAFPRLNNISFWLLPPALFLLLGSSLVEQGAGTGWTVYPPLASIQAHSGGSVDMAIFSLHLAGLSSIL 160
254032057 161 GAMNFITTVMNMRTPGMTMSRIPLFVWSVLITAILLLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILYQHLFWFFG 240
254032053 161 GAMNFITTILNMRTPGMTMSRIPLFVWSVFITAILLLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILYQHLFWFFG 240
254032047 161 GAMNFITTVLNMRTPGMTMSRIPLFVWSVFITAILLLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILYQHLFWFFG 240
254032033 161 GAMNFITTVMNMRTPGMTMSRIPLFVWSVFITAILLLLSLPVLAGAITMLLTDRNFNTTFFDPAGGGDPILYQHLFWFFG 240
254032057 241 HPEVYILILPGFGIISQILSLFSYKKQIFGYLGMVYAMLAIGVLGFIVWAHHMYVVGMDVDTRAYFTAATMIIAVPTGIK 320
254032053 241 HPEVYILILPGFGIISQILSLFSYKKQIFGYLGMVYAMLAIGILGFIVWAHHMYVVGMDVDTRAYFTAATMIIAVPTGIK 320
254032047 241 HPEVYILILPGFGIISQILSLFSYKKQIFGYLGMVYAMLAIGILGFIVWAHHMYVVGMDVDTRAYFTAATMIIAVPTGIK 320
254032033 241 HPEVYILILPGFGIISQILSLFSYKKQIFGYLGMVYAMLAIGVLGFIVWAHHMFVVGMDVDTRAYFTAATMIIAVPTGIK 320
254032057 321 IFSWLATVSGSGRNLIFTTPMAWALGFIFLFTIGGLTGIVLSNSSLDILLHDTYYVVAHFHYVLSMGAVFAIFGGFYLWF 400
254032053 321 IFSWLATISGSGRNLIFTTPMVWALGFIFLFTIGGLTGIVLSNSSLDILLHDTYYVVAHFHFVLSMGAVFAIFGGFYLWF 400
254032047 321 IFSWLATISGSGRNLIFTTPMAWALGFIFLFTIGGLTGIVLSNSSLDILLHDTYYVVAHFHFVLSMGAVFAIFGGFYLWF 400
254032033 321 IFSWLATVSGSGRNLILTTPMAWALGFIFLFTIGGLTGIVLSNSSLDILLHDTYYVVAHFHFVLSMGAVFAIFGGFYLWF 400
254032057 401 GKITGYAYKDIYGLIHFWLMFLGVNITFFPQHFLGLAGLPRRYADYPDNFEDFNQISSFGSIISIIAVIWFIVVIFDAYY 480
254032053 401 GKITGYAYKDIYGLIHFWLMFFGVNITFFPQHFLGLAGLPRRYADYPDNFEDFNQISSFGSIISIIAVIWFVVVIFDAYY 480
254032047 401 GKITGYAYKDIYGLIHFWLMFVGVNITFFPQHFLGLAGLPRRYADYPDNFEDFNQISSFGSIISIIAVIWFVVVIFDAYY 480
254032033 401 GKITGYAYKDIYGLIHFWLMFIGVNITFFPQHFLGLAGLPRRYADYPDNFEDFNQISSFGSVISLTAVIWFIVVIFDAYY 480
254032057 481 REEPFDINIMAKGPLIPFSCQPAHYDTLEWSLTSPPEHHTYNELPYIVGGPKSS 534
254032053 481 REEPFDINIFAKGPLTPFSCQSTHFDTLEWTLTTPPEHHTYNELPYIVGGPKSS 534
254032047 481 REEPFDINIFAKGPLTPFSCQSTHFDTLEWTLKTPPEHHTYNELPYIVGGPKSS 534
254032033 481 REEPFDINTMAKGPLIPFSCQPAHFDTLEWSLTSPPEHHTYNELPYIVGGPKSS 534
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap