Conserved Protein Domain Family
CYTB

?
MTH00022: CYTB 
cytochrome b; Validated
Statistics
?
PSSM-Id: 164595
View PSSM: MTH00022
Aligned: 34 rows
Threshold Bit Score: 567.022
Threshold Setting Gi: 197259882
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124286768   1 MQLRKENPVLSIVNGLIIDLPSPSNISYMWNFGSLLGACLVIQILTGIFLSMHYCADVSLAFASVGHIMRDVNYGFLLRY 80 
115494872   1 MRLRKENAVLSIFNGLVVDLPSPSNISYLWNFGSLLGACLVIQIATGIFLSMHYCADVSLAFSSVGHIMRDVNYGFLLRY 80 
159106780   1 MQLRKQNPVLSIGNGLIIDLPAPANLSYMWNFGSLLGLCLVIQIATGIFLAMHYCADVSLAFASVDHIMRDVNYGFLLRY 80 
107736212   2 LRIRTQHPIISIVNGILVDLPAPSNISYLWNFGSLLGACLAIQLITGIFLAMHYCPDVNLAFDSVSHILRDVNYGFMLKY 81 
159106772   1 MQFRKENPVLSIVNGIIIDLPAPANLSYMWNFGSLLGVCLVVQMATGIFLAMHYCSDVSLAFASVDHIMRDVNYGFLLRY 80 
109156404   1 MPLRKENPLLSPMNGVLVDLSTPSNISYMWNFGSLLGLCLGLQIITGCFLSMHYCADVGLAFASVGHIMRDVNYGFLLRY 80 
109156445   2 LRIRTQHPIISIVNGVLVDLPAPSNISYYWNFGSLLGLCLAIQLITGIFLAMHYCPDVSLAFDSISHILRDVNYGFMLKY 81 
192293781   8 LRVRTQHPLLSIVNGILVDLPAPSNISYLWNFGSLLGACLVIQLITGIFLAMHYCPDVSLAFDSVSHILRDVNYGFVLKS 87 
189095615   8 LRVRTQHPLLSIVNGILVDLPAPSNISYFWNFGSLLGACLVIQLITGIFLAMHYCPDVSLAFDSVSHILRDVNYGFVLKS 87 
200004087   1 MRIRKNNHLIKHINSTLIDLPSPSNINYLWNFGSLLGLCFAIQLVTGIFLAMHYCGDIILAFKSIVHICRDVNYGFLLKS 80 
124286768  81 LHANGASMFFLCVYLHIGRGLYFGSYSRTAVWNVGVVIYVLMMATAFIGYVLPWGQMSFWGATVITNLLSAIPYIGTDIV 160
115494872  81 LHANGASMFFLCLYTHIGRGLYYGSYTKTSVWNVGVIMLILTMATAFVGYVLPWGQMSFWGATVITNLLSAIPYIGTDIV 160
159106780  81 AHANGASMFFICLYAHIGRGLYYGSYSKVEVWNVGVILFILTMATAFIGYVLPWGQMSFWGATVITNLLSAIPYVGTDIV 160
107736212  82 IHANGASLFFLCVYIHMGRGLYYGSYMKMDVWNIGVIIYLIMMLTAFLGYVLPWGQMSFWGATVITNFCSAIPYVGTDIV 161
159106772  81 FHANGASMFFLCLYFHVGRGIYYGSYTKVEVWNVGVVLFILTMATAFLGYVLPWGQMSFWGATVITNLLSAIPYVGTDIV 160
109156404  81 FHANGASLFFLCLYLHIGRGLYYGSYTKASVWRVGVVIFLLTMATAFMGYVLPWGQMSFWGATVITNLLSALPYVGTDIV 160
109156445  82 IHANGASLFFLCVYIHMGRGLYYGSYMKMDVWNIGVIIYLVMMLTAFLGYVLPWGQMSFWGATVITNFCSAIPYIGTDIV 161
192293781  88 IHANGASLFFLCVYIHMGRGLYYGSYMKTDVWNLGVIIYLIMMLTAFLGYVLPWGQMSFWGATVITNFCSAIPYVGSDIV 167
189095615  88 IHANGASLFFLCVYIHMGRGLYYGSYMKTDVWNLGVIIYLIMMLTAFLGYVLPWGQMSFWGATVITNFCSAIPYVGSDIV 167
200004087  81 IHANGASLFFICVYIHIGKSLYYGGYQKKPIWFSGIIIFIVMMITAFIGYVLPWGQMSFWGATVITNFLSAIPYIGDDIV 160
124286768 161 QWVWGGFSVSNATLNRFYSLHYLLPFILAALALVHLICLHVEGSNNPIGVKSDVDKVSFHVYYTSKDWYGIVALAVILAA 240
115494872 161 QWVWGGFSVSNATLNRFFSLHYLFPFLLVALAGIHLICLHEEGSQNPIGVRSDFDKVSFHVYYTSKDWYGIVVLTMVLSI 240
159106780 161 QWVWGGFSVSNATLNRFFSLHYLFPFILAALSAIHLICLHVDGSNNPIGVKSDLDKVAFHVYYTSKDWYGIVAFSVFFCA 240
107736212 162 QWIWGGFSVSNATLNRFYSLHYLFPFLIVGLAVLHIISLHTDGSNNPLGISSNIDKVTFHAYYTYKDLFGIMVLGVILVI 241
159106772 161 QWVWGGFSVSNATLNRFFSLHYLLPFVLAALGVVHLICLHVSGSNNPIGVRSDLDKVPFHTYYTSKDWYGIVAFVLFFCS 240
109156404 161 QWVWGGFSVSGATLTRFFSLHFLFPFLLAILAGVHIVYLHVEGSNSPVGSKSPVDNVVFHVYYTSKDWYGIVITLMLLSV 240
109156445 162 QWIWGGFSVSNATLNRFYSLHYLFPFLIAGLGVLHIISLHTAGSNNPLGIDSNIDKVTFHVYYTYKDLFGMMVLGTILVI 241
192293781 168 QWIWGGFSVSNATLNRFFSLHYLFPFLIVGLALLHVISLHTDGSNNPLGISSNIDKVTFHVYYTYKDLFGIMVLGAMLVI 247
189095615 168 QWIWGGFSVSNATLNRFFSLHYLFPFLIVGLALLHIISLHTDGSNNPLGISSNIDKVTFHVYYTSKDLFGIMVLGAMLVI 247
200004087 161 QWIWGGFSVNNATLGRFFSLHYLFPFVLASLILIHIVLIHSVGSSNPLGINSNFDKVPFHWYFAIKDIYGFFILIFILLF 240
124286768 241 IVYITPNLLGDPENFIQANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVVAMFSSFLILFLMPWLHSSRFRGLTFRPLA 320
115494872 241 IVYLAPNLLVDPENFIQANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVIAMFASLLILFLLPWLHRSRFRGLPFRPLG 320
159106780 241 LVYLAPNLLGDPENFIQANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVIAMFASLLVLFLLPLLHTSRLRGLTFRPLG 320
107736212 242 ISYFMPNVLGDPENFIQANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVLAMVASILVLLLLPFIHTSKLRALTFRPLG 321
159106772 241 LVYLAPNLLGDPENFIQANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVVAMFASLLILFLLPWVHTSRLRGLTFRPLA 320
109156404 241 VVYLAPNLLGDPENFIQANSLVTPVHIQPEWYFLFAYAILRSIPNKLGGVVAMFSSILILLFFPLLHRSWLRGLPFRPFG 320
109156445 242 LCYFTPNVLGDPENFIQANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVLAMVFSILVLLLLPFVHTSKLRALTFRPLG 321
192293781 248 ISYFMPNVLGDPENFIQANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVLAMGASILVLLLLPYIHTSKLRALTFRPLG 327
189095615 248 ISYFMPNVLGDPENFIQANPLVTPVHIQPEWYFLFAYAILRSIPDKLGGVLAMGASILVLLLLPYIHTSKLRALTFRPLG 327
200004087 241 IVFFYTNTLGDPENFINANSLVTPVHIMPEWYFLFAYAILRSIPNKLGGVLALILSIVILFIIPFLHTNKFFSLTFRPIG 320
124286768 321 RLAFWFFAADFILLTWIGSQPVEEPFIIIGQLASIFYFSYFLVITPLLGHFENWLTSNP 379
115494872 321 RVAFWFVVADFLLLTWIGSQPVEEPFIIIGQLASIFYFSYFLIITPLLGYLENQLLVRS 379
159106780 321 RMAFWFFVANFLLLTWIGSQPVEEPFILIGQIASMFYFAYFLVIAPLLGYLENRLLFPG 379
107736212 322 KLAFWFLIADFILLTWIGANPVEEPYVLIGQFASMFYFCYFLLLIPLLGWAETKLLRMK 380
159106772 321 RVAFWFMVTDFMLLTWIGCQPVEEPFIIVGQLASVFFFAYFLVLSPLLGYLENLLLFPK 379
109156404 321 RIAFWFLIVDFFLLTWIGSLVVEEPFILIGQLVSLFYFSYFLIWIPLLGELENQLLFFW 379
109156445 322 KIAFWFLVADFVLLTWLGANPVEEPYVMVGQFASLFYFFYFLILIPLLGWVETKLLRIK 380
192293781 328 KIAFWFLVADFILLTWLGANPVEEPYVMVGQFASLLYFFYFLVLIPLLGWVETKLLRIK 386
189095615 328 KIAFWFLVADFILLTWLGANPVEEPYVMVGQFASLLYFFYFLVLIPLLGWVETKLLRIE 386
200004087 321 KLLYWVFIANFILLTWLGSKPIENPYILISIISSLFYFFYFLFIIPIIGKLENYLFFQK 379
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap