Conserved Protein Domain Family
ND3

?
MTH00018: ND3 
NADH dehydrogenase subunit 3; Validated
Statistics
?
PSSM-Id: 164592
View PSSM: MTH00018
Aligned: 34 rows
Threshold Bit Score: 141.738
Threshold Setting Gi: 157149648
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
71733156    1 MRFFVFCFLTIVLAGLFSMVSFFLGEKVPDREKVSAYECGFVPFSFLGRPFSIRFFLIGILFLIFDLEISFFFPWCVLYN 80 
164565486   2 INLFIFFFLIFILAGLFIFLSFLIGEKTPDREKVSAYECGFAPFNFLGRPFSIRFFLIGILFLIFDLEISFFFPWCVLYN 81 
109156447   4 KGILILLIVSGTLSILILGASYLLGYKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLIGILFLIFDLEISFLFPWAVTYK 83 
107736214   4 KGILILLIVSGTLSILILGASYLLGNKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLIGILFLIFDLEISFLFPWAVTYM 83 
189095617   4 KGILILLIVSGTLSIIILGASYLLGNKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLIGILFLIFDLEISFLFPWAVTY- 82 
192293783   4 KGILILLIVSGTLSIIILGASYLLGNKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLIGILFLIFDLEISFLFPWAVTY- 82 
197253937   2 INLFIFFFLIFILAGLFIFLSFLIGEKIPDREKVSAYECGFAPFNFLGRPFSIRFFLIGILFLIFDLEISFFFPWCVLYN 81 
197259890   2 VNLFIFFFFIFILAGLFIFLSFLIGEKVPDREKVSAYECGFAPFNFLGRPFSIRFFLIGILFLIFDLEISFFFPWCVLYN 81 
164420817   3 LNLFIYLITSFLLSLIVLFFSIFLSFKSPDKEKVSIYECGFNPXHSTGQPFSIRFFLIAILFLIFDLEIIYLFPWSVNTN 82 
270267569   4 KGILILLIVSGTLSILILGASYLLGYKQPDMEKVSVYECGFDPFDNPGNPFSVRFFLIGILFLIFDLEISFLFPWAVTYM 83 
71733156   81 SIAPFGFWTMVGFFFILTLGLVYEWLKGGLEWE 113
164565486  82 STAPFGFWTMIGFFFVLVLGLIYEWVMGGLEWE 114
109156447  84 GLPLFGYWVVMLFLFILTLGLIYEWIEGGLEWE 116
107736214  84 SLPLFGYWVVMLFLFILTLGLVYEWIEGGLEWE 116
189095617  83 -MALFGYWVVMLFLFILTLGLVYEWIEGGLEWG 114
192293783  83 -MALFGYWVVMLFLFILTLGLVYEWIEGGLEWE 114
197253937  82 STAPFGFWTMIGFFFVLVLGLIYEWVMGGLEWE 114
197259890  82 SIAPFGFWTMIGFFFVLVLGLIYEWVMGGLEWE 114
164420817  83 LINYYSQSIIFIFIIILTLGLIYEWLRGGLEWE 115
270267569  84 GLPLFGYWVIMLFLFILTLGLIYEWIEGGLEWE 116
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap