Conserved Protein Domain Family
CYTB

?
MTH00016: CYTB 
cytochrome b; Validated
Statistics
?
PSSM-Id: 177102
View PSSM: MTH00016
Aligned: 14 rows
Threshold Bit Score: 562.376
Threshold Setting Gi: 15341651
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
8404658     1 MLRSVR-----------SVLDVPMPVNLSASWNFGSLLGAVLTLQILSGVFLSMHYLPSSDLAFMSIDHIMRDVNGGWVI 69 
172088178   1 MFSPIRkthpaikilnsSLVDLPAPSNLSIWWNFGSLLGLCLIIQLVTGLFLSMHYTPHVELAFSSVAHISRDVNYGWFL 80 
6137770     1 MFSPVRkthpgikiangALVDLPAPGNLSIWWNFGSMLGVCLVIQILTGLILSMHYSPHTDLAFSSVTHIMRDVNYGWIL 80 
52696464    1 MFSPMRkshplfkimnnALVDLPAPNNLSIWWNFGSLLGLCLGIQIITGILLAMHYTPHIDIAFSSVAHITRDVNYGWLM 80 
219524276   1 MFKPMRkthpvlkvinfFLIDLPAPANLSIWWNFGSLLGLCLVIQLVTGLFLAMHYTPHVDLAFSSIAHIMRDVNYGWLL 80 
164420831   1 MKNQMMkhnpm-gkmanSLIQLACPKNISALWSFGSLLGLCLITQILTGIFLAMFYIPNIYQAFDSAIYISRDVNFGWLI 79 
169794158   1 MYSPIRkshpllkmmsgSFSDLPSPSNFSIWWNFGSLLGLCLVIQILSGLFLSMHYTSHVDLAFSSVAHIGRDVNYGWLL 80 
169794172   1 MHSPIRkhhpllkivsgSLVDLPSPSNFSIWRNFGSLLGLCLIIQLVTGVFLSMHYVGHIDLAFSSVSHIVRDVNYGWLL 80 
219524194   1 MTKPFLqkhtl-gkmwmSLVSLAVPKNISALWSFGSLSGLCLVLQILTGLFLAMFFSADTTIAFDSAIRISRDVNYGWLI 79 
190349592   1 -MLIWRknfniikianlALVDLPTPSNLTFWWNFGSMLGICLIIQILTGLMISMHYSGHIDIAFQSIIHTSRDVNYGWLM 79 
8404658    70 RLVHVWGSSMFFFLLYCHMGRGIYYGSFSLAAVWGVGVVIFIASMATAFLGYVLPWGQMSFWGAPVITNIFSAIPYLGKS 149
172088178  81 RNLHANGASWFFICIYLHVGRGMYYASYKNQETWNIGVVLLLLTMATAFVGYVLVWGQMSFWGATVITNLLSAIPYIGKS 160
6137770    81 RYMHANGASWFFICIYLHIARGIYYGSYLYVETWNIGVILVVLVMATAFVGYVLPWGQMSFWGATVITNLLSAIPYIGPM 160
52696464   81 RTIHANGASLFFLCIYMHIGRGLYYGSYSYMETWNIGVILLLLTMAAAFLGYVLPWGQMSFWGATVITNLFSAIPYIGTN 160
219524276  81 RYLHANGASFFFICLYLHVGRGIYYGSYLYLETWNIGVILLSLTMATAFVGYVLPWGQMSFWGATVITNLLSAIPYIGKM 160
164420831  80 RSIHANSASMFFICIYTHTGRGIYYSSHQMKETWMVGVTLLLITILTAFLGYVLPWGQMSFWAATVITNLLSAIPYLGST 159
169794158  81 RSIHANGASFFFMCLYCHIGRGMYYMSYFFMETWNVGVVIFFLTMGTAFVGYVLPWGQMSFWGATVITNLASAIPYIGEI 160
169794172  81 RSVHANGASFFFICLYLHVGRGMYYMSYFFMETWNIGVVIFILTMATAFVGYVLPWGQMSFWGATVITNLLSAIPYVGEM 160
219524194  80 RNMHANGASMFFVCLYIHIGRGLYYKSYKNMETWLIGVTLLFLTILTAFMGYVLPWGQMSFWAATVITNLVSAVPYLGND 159
190349592  80 RYIHMNGASFFFICLYFHISRGIYYGSFFLTHTWMVGVSLLFLMMATAFLGYVLPWGQMSFWGATVITNLVSAIPYFGLM 159
8404658   150 LVIWLWGGFSVGGPTLTRFYTLHFLLPMVLVGLVLVHIFLLHETGSSNPLGVKVSSgGLVPFHPFYTSKDFVGVLGVGFL 229
172088178 161 IVEWLWGGFAVDNATLNRFFAFHFLLPFAIAAVTVIHLLFLHQSGSNNPLGINSDS-SKIAFHTYYTVKDIVGFIFMIMS 239
6137770   161 LVEWVWGGFAVDNATLNRFFALHFLLPFVVMAMSILHLLFLHQTGSNNPLGIKSMM-NMVPFHMYYTFKDIVGFTVLLMT 239
52696464  161 LVQWMWGGFAVDNATLNRFFAIHFFVPFIIAALTVIHLLFLHLTGSNNPLGIASDS-DKIPFHWYYSSKDILGFIIVILM 239
219524276 161 LVEWIWGGFAVANATLNRFFAFHFLLPFIIMALSVLHLLFLHQTGSNNPLGINSNS-DKVPFHTYYTTKDLTGLIVMLGA 239
164420831 160 IVNWIWGGFSVSNATLTRFYALHFLFPFLISALSLMHIIFLHQSGSSNPLGLNSNN-ETMKFHIYFSAKDLIGVILLWIM 238
169794158 161 LVQWVWGGFSVDNATLTRFFSFHFLFPFMIAGLSMVHLLFLHQTGSNNPLGLNSDC-DKIPFHWFYSTKDIAGFLVFFFV 239
169794172 161 IVQWVWGGFSVDNPTLTRFFSFHFLLPFVIAALSGLHLLFLHQTGSNNPLGLNSDF-DKVPFHWYYSTKDAVGFLVLLML 239
219524194 160 VVMWIWGGFSVSNATLTRFYGLHYLMPLVIAVLSMIHIIFLHETGSNNPLGVKTNN-EIMKFHPYFTIKDLFGPFIMWAM 238
190349592 160 VVQWLWGGFSIDNATLTRFFSLHFILPFVISALVMVHLLFLHTTGSSNPIGLESDL-DKISFHPYFSIKDLFGLMMMIFI 238
8404658   230 ILGGAFLWPYFLSDPENFAPANPLVTPTHIMPEWYFLWVYAILRSIPNKVGGVVVMFSSLLILFGVPLLYTG-KFQGSSM 308
172088178 240 LLAVALFWPTSLGDPDNFLPANPLVTPAHIKPEWYFLWAYAILRSIPNKLGGVVAMFAAILVLFLIPLINNP-SMTGNTF 318
6137770   240 LTFIALFFPNILGDADNFIPANPLVTPIHIKPEWYFLWAYAILRSIPNKLGGVVAMFTAILILFTLPLMAKQ-KIRGLSF 318
52696464  240 FAMLALLAPNALGDPENFLPANPLVTPTHIKPEWYFLWAYAILRSIPNKLGGVVAMFAAVLILLTLPFTITQ-SRRSTSF 318
219524276 240 LTFLTLLAPNFLGDPENFIPANPLVTPLHIKPEWYFLWAYAILRSIPNKLGGVVAMFAAILVLFALPFIFTS-KVRGMAF 318
164420831 239 LGSVVLLKPNLLIDPENFIPANPLVTPTHIQPEWYFLPMYAILRSIPNKLGGVLALIMSIAILYFLPMMNKP-ITKSASM 317
169794158 240 FFIVVLLYPNGFTDPENFIPANPLVTPVHIQPEWYFLFAYAILRSIPNKLGGVVSLVASIAILFCLPLTISLmKFRSLVF 319
169794172 240 LFSMATLFPNALTDPENFIPANPLVTPVHIQPEWYFLFAYAILRAIPNKLGGVIALFMSLLVLLTLPVTKGLyKFRGLSF 319
219524194 239 LGVVVLFMPSVLIDPENFIPASPLVTPTHIQPGWYFLPMYAILRSIPNKLGGVIALVASIAILYFMPFIK---KMKSNSF 315
190349592 239 LMLMVLLNPFIMSDPENFIPANPLMTPIHIKPEWYFLFAYAILRSIPNKLGGVVSLVMSISILFFIPMMFKL-KFQSYSF 317
8404658   309 YPLSQFLFWGFVSVMVLLTWIGHSPVESPYTSLGLELTVVYFFFFFLYPLSEKVWDSVLY 368
172088178 319 YPVSQILFWALVIDTMWLTWIGGCPVEAPYETLGQIFTFAYFFIHLINPLAAKLWDYLSD 378
6137770   319 YPIGQCMFWLLAVNTVMLTWIGGQPVEYPYEGLGQVFTAFYFVLHISIPTSAQLWDKMTM 378
52696464  319 YPLNQILFWTLITNMLLLTWIGGCPVEAPYELLGQIFTTYYFIYFMFNPILFYLWDNLLK 378
219524276 319 YPLNQTMFWTFVANALLLTWXGGQAVEPPFETLGQIFTALYFMYFVAHPLLTRAWEKALL 378
164420831 318 NPKNKIAFWLLVTNFIVLMWIGSKPVESPFEEIGQIMTVTYFSIYMIMSKN--------- 368
169794158 320 YPLNQILFWSFCSIFLLLTWIGMRPVEDPYIFIGQILTVLYFSYFLLNPLILKFWDNLY- 378
169794172 320 YPVSQILFWIFCSIFLLLTWIGMRPVEDPYIFIGQVLTLFYFFYFLINPIVVKLWEKLY- 378
219524194 316 SVINQILFWSLVSIFIVLMYIGAKPVEPPFEGVGQIFTVFYFTMYVIMT----------- 364
190349592 318 YPLNQVLFWYLISVILLLTWIGVRPVEPPFILIGQVLTMMYFIMYMILSFLMSFWNNV-- 375
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap