Conserved Protein Domain Family
ND6

?
MTH00015: ND6 
NADH dehydrogenase subunit 6; Validated
Statistics
?
PSSM-Id: 164590
View PSSM: MTH00015
Aligned: 4 rows
Threshold Bit Score: 126.895
Threshold Setting Gi: 150375683
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5835196     1 MILTSFMLMMIATTFTLYLASTPIVLGVNILMMALLLASTFASFMSSWFAFLIFLIYIGGMLVMFAYFLALTPNQQISNF 80 
150375683   1 MLLMMFFILMITSTMMLFLATTPIMLGINILAMALLLAATLASSTSSWYAFLVFLIYVGGMLVMFAYFLALTPNQQMPTT 80 
238866914   1 MSLSFTLILSMSLICSLFLATSPLTLGIWVLVLALMIATTMALALSSWFGMITFLIYVGGMMVMFSYFAALSPNQQLNLG 80 
54310664    1 MSLSFTLILSMSLICSLFLATSPLTLGIWVLILALMIATTMALALSSWFGMITFLIYVGGMMVMFSYFAALSPNQQLNLG 80 
5835196    81 NIMPYALITLLTFSALTYTTNIKIPTFSDISQGNSILYMSSTAPFLILLALILLLTMVIVVKLTSRSSGPLRPFS 155
150375683  81 TNILYTMITIITLSLMMLLTNTTPPISNSLYQGNQYLYSLDSAPILVILALILLLTMVIVVKLTYRSKGPLRPFH 155
238866914  81 PMAKTTMVTLLLLSTTLKLFSPPSLSQFTSTPKLTFMYQPENLSLLIFFGSILFFALIAVVKISRRESGPLRPFK 155
54310664   81 PMAKTTLATLLLLMTTLKFFAPPSLSPFSSTPKLTFMYQPENLSLLIFFGSILFFALVAVVKISRRESGPLRPFK 155
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap