Conserved Protein Domain Family
ND4L

?
MTH00013: ND4L 
NADH dehydrogenase subunit 4L; Validated
Statistics
?
PSSM-Id: 133655
View PSSM: MTH00013
Aligned: 6 rows
Threshold Bit Score: 88.2694
Threshold Setting Gi: 5835200
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
150375687  2 INTTQTILCLLPIMAMMNMLLNQTHFLMTLLSLEGITLSLVLFIPLILMNAQAPNAAMAVILLTFGACEASLGLSLMVTM 81 
5835200    2 YSSIMSLVFLLPIVAVVNLISNQSHFLMTLLSLEGITLSLVLFVPISLSIMSASNVSISVILLTFGACEASLGLSLMVLM 81 
54310658   1 MTSPLFLFSISGLICLFVLSLQRKHLLMSLLTLEAFILSMAILIPMSIMFQNQVNGMFAIVLLTMGACEASLGLSLLVLM 80 
192288414  1 -MILLMILSCSVFFSMLTFSIQRKHLLMSLLSLEAMILTLTMLTVCSLGLAPQFNTYLFIVLLTFGACEASLGLSLLVAM 79 
192288386  1 -MTSPFIMIISFFSSTASLLIQRKHLLMSLLSLEAMMLSMACFIMFSIGSTIQWNPFLFIVVLTFGACEASLGLSLLVII 79 
238866908  1 MTSPLFLFSISGFICLFVLSLQRKHLLMSLLTLEAFILSMAILIPLSIMFQNQVNGMFAIVLLTMGACEASLGLSLLVLM 80 
150375687 82 SRSYGNDMLKSLTSTKC 98 
5835200   82 SRSYGTDMLNSLTANKC 98 
54310658  81 TRSYGNDLLKSITKNLC 97 
192288414 80 TRYFGNDYTNLLTMNKC 96 
192288386 80 TRTSGSDMMKTLSSSKC 96 
238866908 81 TRSYGNDLLKSITKNLC 97 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap