Conserved Protein Domain Family
ND3

?
MTH00012: ND3 
NADH dehydrogenase subunit 3; Validated
Statistics
?
PSSM-Id: 164588
View PSSM: MTH00012
Aligned: 4 rows
Threshold Bit Score: 163.876
Threshold Setting Gi: 54310662
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5835203     1 MILTALSSAIALLVPIIILGAAWVLASRSTEDREKSSPFECGFDPKSTARIPFSTRFFLLAIIFIVFDIEIVLLMPLPTI 80 
150375690   1 MNLATSMFMISMSIPLLVLLAAWVLAARSTNDREKLSPFECGFDPQNSARIPFSMRFFLLAIIFIVFDIEIVLLMPVPTL 80 
238866912   1 MSMMMIPMMISLILPPAVFGLAFCLAARSSADREKTSPFECGFDPHKTARQPFSLRFFLLAVVFLVFDIEIVLLLP---I 77 
54310662    1 MSMMMIPMMISLILPPVVFALAFCLAARSSADREKTSPFECGFDPHKTARQPFSLRFFLLAVVFLVFDIEIVLLLP---I 77 
5835203    81 LHTSDVFTTVTTSVLFLMILLIGLIHEWKEGSLDWSS 117
150375690  81 LMTSYSPHVMLTYTLFILILIMGLIHEWNEGSLDWSA 117
238866912  78 VVETTSKMVVYGSIIFLLILVVGLLHEWREGSLDWTS 114
54310662   78 VMEATSKTVVYGSIIFLLILVIGLLHEWREGSLDWTS 114
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap