Conserved Protein Domain Family
ND2

?
MTH00011: ND2 
NADH dehydrogenase subunit 2; Validated
Statistics
?
PSSM-Id: 164587
View PSSM: MTH00011
Aligned: 6 rows
Threshold Bit Score: 291.683
Threshold Setting Gi: 6137775
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
172088185   1 MTSSFPYISLFFSTMTLGTLMTLSANQWLYVWMGLELNLLSFVPLITSSSMNRESEAAMKYFLAQAMGSGLLLLGvfTNM 80 
5835204     2 KYIKSPTMALAMSTLIMSTLMAVSSANWMFLWGAMELNLLSFIPIMMQSNNNQETEGAVKYFLAQALGSALLLMS--STS 79 
150375691   2 TFMWSPTMMLASTTLITSTLMALSSTNWLFLWASMELNLLSFIPILISSKMNREIESAVKYFLAQALGSALLLTS--SIM 79 
6137775     1 ---MTPSSLLFFSTTTMGTLMVLSSNNWLLLWMGMELNLLSFVPLIASSQLFQETEASVKYFIIQAIGSGVMLMAgvMSM 77 
54310660    1 MMSTFPHLFLFSSTMVLGTMISLSSSNWVMIWLGMELNLMSFLPLMTLSKQNQESEAAIKYFLAQCWGGSFFLLG--MTL 78 
238866910   1 MMSTFPHLFLFSSTMVLGTMISLSSSNWVMIWLGMELNLMSFLPLMTLSKQNQESEAAIKYFLAQCWGGSFFLLG--MTL 78 
172088185  81 MFSAPSLTINPGASFIFFALLLKLGAAPCHFWFPAVMSNISWPLCMTLATWQKIAPLNILMFSNSLNQSSLVLSVAALGS 160
5835204    80 MWMTFSMISNFMPLTLMAAIMLKLGSVPCHFWYPSVMASISWVSCLILSSWQKLAPLSILAFLLPQKNMNFMLSMAAMNA 159
150375691  80 MWSPYSFAPSVTAMMLTMSILLKLGSAPCHLWYPSVMSGITWMSCTILSSWQKLAPLSILIFFTSITPKPIIPMMAAMNA 159
6137775    78 SAPSSALMKHTTSLMFLLSMVVKLGMAPCHQWLPHVMSSMSWLMCLVLSTWQKVSPLMMLNTITPHNITAYITFIAMASA 157
54310660   79 SYFFPSQLKIIPVLIILVSLMMKAGMAPCHFWFPSVMNSMSWTLCLLLSTWQKITPLLLLFTFANSSALPMMTLLGATSI 158
238866910  79 SYFFPSQLKFIPILIVLVSLMMKAGMAPCHFWFPSVMNSMSWTLCLLLSTWQKITPLLLLFTFSSPSTLPMMTLLGATSI 158
172088185 161 LIGGIGGLNQTQLRPLFAYSSIGHLGW---MISTPSFLTLIIYLTIYIFITSAMMIIFWKLSTKHWSFNISLLKSSPATT 237
5835204   160 LLGGVIGMNQTQLRTIMAYSSIGHIGWmmsLAAVYKPSSCIMYFVVYCILITPLFMTMGYLNMFSTKHMSKLSSYSSTVH 239
150375691 160 LFGGMMGMNQTQLRAIMAYSSIGHLGWimaFMVVSKPALSMIYFMVYCTLILPLFLVFNYMNIMTSKQLSKASSIPFSTQ 239
6137775   158 IVGGLGGANQSQMRALLAYSSIGHMGWm-lMAIQFSSSIFSLYFMTYLIITSSLMLMMFNVSSFNSNFNSNIAQMSYISF 236
54310660  159 IAGSLGGIMQTQVRPLLAYSSISHMGWm-tVISPFSMSMAILYLTTYIIMTTPIMILLAQSNALSTKSTTLISSMGQTNS 237
238866910 159 IAGSLGGIMQTQVRPLLAYSSISHMGWm-tVISPFSTSMAILYLSTYIIMTTPIMLLLAQSNALSTKSTNLISSMGQTNS 237
172088185 238 FSIIILLFSLAGLPPFIGFLPKWLILSSLTSsgASLLWPLVLVLGSAIQLFYYLSLMFAFFMKSPNYSSLTFSPSSSKNQ 317
5835204   240 MALLMVLLSLGGLPPFTGFMPKLMTIMLLMQ--SMKIILLILIAGSIMNLFFYLNIIISSMPLPPHLKNVDSTDIKCSLK 317
150375691 240 MSLVILLLSLAGLPPLTGFMPKLMAITSLAS--QNISLILLLIVGSLMNLYYYLNIIV-NMSLVNQVITFNYVRYTLKTK 316
6137775   237 AMMMIMMFSLGGLPPFLGFLPKWMIINTMTAk-EMFLILITLITGSLLNLFYYFSMLFNFITMMKTCSN--SAPTPGANL 313
54310660  238 LWFFLMILSLGGMPPTTGFMIKLIAVETLVNn-SMILPTIVFLVAATVNLSFYLNLVF-YTYISSTFVSLKHA-YEPKTA 314
238866910 238 LWFFLMILSLGGMPPTTGFMIKLIAVETLVNn-SMVLPTILFLVAATVNLSFYLNLVF-YTYLSSTFTSLKHA-YEPKTA 314
172088185 318 IITCIAT-ATLGLAP 331
5835204   318 FVIPICT-LSLGLSP 331
150375691 317 VLLFMSSvLSIGLLP 331
6137775   314 ILTSLCT-----LTP 323
54310660  315 IPISMFAiSMFWLIP 329
238866910 315 IPISMFAiSMFWLIP 329
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap