Conserved Protein Domain Family
ND1

?
MTH00010: ND1 
NADH dehydrogenase subunit 1; Validated
Statistics
?
PSSM-Id: 164586
View PSSM: MTH00010
Aligned: 6 rows
Threshold Bit Score: 431.897
Threshold Setting Gi: 192288416
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
192288388   1 MNIPFILSIVISYLMAMLAMAFYTLLERKALGYFQLRKGPNKVGLGGIPQPFADAMKLFTKEQTKPKFANMLPYIIAPMT 80 
150375689   1 MSITFFTSLLLSIILALVAMAFYTLMERKFLGYFHLRKGPNKVGLMGIPQPFSDAIKLFVKEQAKPSPANISPFMVAPTM 80 
5835202     1 MNIPFFTSVLMSLVLALLAMAFYTLMERKFLGYFHLRKGPNKVGLMGLPQPFADAIKLFVKEQAKPNPSNQTPFLFAPTM 80 
192288416   1 MNLSFFISITISYIMALLAMAFYTLLERKALGYFQLRKGPNKVGIAGIPQPFADAIKLFTKQLNKPMLANYTPFLLAPMC 80 
238866911   1 MPISFSIAMILNMVSAMLAMAFFTLLERKTLGYMQLRKGPNKVGIAGIPQPFADVLKLLTKEQTSPSMSNIAPFVGAPIF 80 
54310661    1 MSISFSIAMILNMVGAMLAMAFFTLLERKTLGYMQLRKGPNKVGIAGIPQPFADVLKLLTKEQTSPSVSNIAPFVGAPIF 80 
192288388  81 SLILALLLWSLYPFKTPAYFIKFSILLFLCISSINVYTTLGAGWASNSKYALLGAMRSVAQTISYEVSMSLILLTCLLTH 160
150375689  81 GLILALMMWAIYPHAHQSYFLHFSVLYFLCVSSMNVYATFMAGWSSNSKYALLGALRGVAQTISYEVSMSLILLSALMLL 160
5835202    81 GLVLALLMWVIYPHSHQSFFIQFSVLYFLCVSSMNVYTTFLAGWSSNSKYALLGALRGVAQTISYEVSMSLILLSSLIIL 160
192288416  81 SLLLTLLLWSLAPFSSPSFFLKFGALTFLCISSLNVYTTLASGWTSNSKYALLGALRSVAQTISYEVSMALIFLSALCLL 160
238866911  81 ALILILMLWSLYPHKYNVLVIPFGIVLFLAVSSMNVYPTLGAGWTSNSKYALLGSLRSVAQTISYEVSMTLILLAMLLIL 160
54310661   81 ALILILMLWSLYPHKYNILMLPFGIVLFLAVSSMNVYPTLGAGWTSNSKYALLGSLRSVAQTISYEVSMTLILLAMLLIL 160
192288388 161 YSFSMSHIYysKSSWTLLCLMPIFFSWFISRLAETNRTPFDLAEGESELVSGFNTEYSSGSFALIFMAEYANILVMSLFS 240
150375689 161 MTMDFTKMV--NYSWISLMMIPLTVTWFITTLAETNRTPFDFAEGESELVSGFNVEYSSGLFAMIFMAEYMNILIMCLFT 238
5835202   161 STMDFTKMF--SYSWILFMFIPLAVVWFITNLAETNRTPFDFAEGESELVSGFNVEYSAGLFALIFMAEYANILIMSLFT 238
192288416 161 LSFNLSNFItnQNFPIFLFTLPLFFSWFTTTLAETNRTPFDLAEGESELVSGFNIEYSSGTFALIFMAEYASILIMCFIS 240
238866911 161 QTYSFNTIImsQMSWPLLMIPPLTVIWFITNLAETNRAPFDFAEGESEIVSGFNVEYGSGGFALIFMAEYMSIIVMSLFT 240
54310661  161 QTFSFNAIImtQMSWPLLMIPPLTVIWFITNLAETNRAPFDFAEGESEIVSGFNVEYGSGGFALIFMAEYMSIIVMSLFT 240
192288388 241 VIFFTSqVPPYIITEPMLILKTMTLAFLFIWIRASFPRMRYDRLMNLTWKTFLPLSLSSLILSISLMKLSL 311
150375689 239 STIFMG-MPYITISDTMLITKTVFLAMVFVWVRATFPRMRYDHLMNLTWKTFLPMSLTSLMIVLPITTLIT 308
5835202   239 SVIFMStCASGMASDLVLILQTITLAMLFVWVRATYPRMRYDHLMNLTWKSFLPLSLALLMMSIPIAMML- 308
192288416 241 TAVFLAsSTTFFFIDASMIMKTFILAFIFLWIRATFPRMRYDPLMSLTWKSFLPMSLTYLLIIPSFMLLFW 311
238866911 241 AVFLTPfIPSTLISPLWICGMTVFISILFIWARGSLPRMRYDRLMSLTWKMFLPFALGTLMAFMPMMFLML 311
54310661  241 AVFLAPfIPSIFLSPMWVCAITVFVSILFIWARGSLPRMRYDRLMSLTWKMFLPFALGTLVIFMPLMFLLL 311
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap