Conserved Protein Domain Family
COX3

?
MTH00009: COX3 
cytochrome c oxidase subunit III; Validated
Statistics
?
PSSM-Id: 177101
View PSSM: MTH00009
Aligned: 9 rows
Threshold Bit Score: 423.864
Threshold Setting Gi: 172088189
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5835195     1 MIRQPFHLVEYSPWPLTSSIGAFTLAIGLASWFHNHGFLCLTLAAFLIIVSMIQWWRDVVREGTYMGHHTSLVTTGLRWG 80 
150375682   1 MIRQPFHLVEYSPWPLTSSLGAFTLAIGLASWFHGYGLTCFLIAIILIISSMCQWWRDVVREGTYMGHHTSHVTTGLRWG 80 
192288381   1 MLRQPFHLVELSPWPLTGSIGAFALTVGTASWFHGYGTKCAILGVIIILLTMIQWWRDIIREGAFMGHHTSYVAKGLRWG 80 
192288409   1 MTRQPFHLVEYSPWPLTGAMGAFSLTVGTASWFHGFSPLPMFLGTLIILLTMLQWWRDIIREGTFMGHHTSYVTKGLRWG 80 
6137773     1 MVRQPFHLVEFSPWPLTGSLGAFALTVGLTAWFHGYGLTCMIMGLIIIGLTMVQWWRDVIREGLFMGHHTSYVNKGLRWG 80 
238866913   1 MLRHPFHLVELSPWPLTGSIGAFTLVIGLTSWFHNYGTLPLILGLVLIIATMIQWWRDVIREGTYMGFHTSYGTKGLRWG 80 
54310663    1 MLRHPFHLVELSPWPLTGSIGAFTLVIGLTSWFHNYGTLPLILGLVLIIATMLQWWRDVIREGTYMGFHTSYVTKGLRWG 80 
172088189   1 MIRQPFHLVEFSPWPLTGSIGAFALTVGLAAWFHGFSMSCMLLGLAIILITMIQWWRDVIREATYLGHHTSIVTKGLRWG 80 
52696462    1 MVRQPFHLVEPSPWPLTGSIGALTLTGGLAAWFHGHGMTILQLGILIVALTMIQWWRDVVREATFMGHHTTVVSKGLRWG 80 
5835195    81 MILFITSEVMFFLAFFWAFFHSSLSPTPEIGCSWPPTGIHPLNPFSVPLLNTAVLLASGVTVTWAHHSLMSGKRIDATQA 160
150375682  81 MILFITSEVMFFFAFFWAFFHSSLAPSPEIGCAWPPTGINPLNPFSVPLLNTAVLLASGVTVTWAHHSLMEGDRTNSIQA 160
192288381  81 MILFIASEVMFFFAFFWAFFHSSLAPTPELGCCWPPTGIQPLNPFSVPLLNTAVLLASGVTVTWAHHSLIEGNRTDAVKA 160
192288409  81 MILFISSEVMFFFAFFWAFFHSSLAPTPDLGCSWPPTGIFPLNPFSVPLLNTAVLLASGVTVTWAHHSLIEADRPGATQA 160
6137773    81 MILFIASEVLFFLAFFWAFFHSSLAPTPELGCSWPPTGVTPINPFSVPLLNTAVLLASGVTVTWAHHSLMEGARPESIQA 160
238866913  81 MILFIASEVLFFFAFFWAFFHSSLAPTPELGCMWPPMGIEPLNPFSIPLLNTAVLLASGVTVTWAHHSLIEQDKHNTTAA 160
54310663   81 MILFIASEVLFFFAFFWAFFHKSLAPTPELGCMWPPTGIEPLNPFSIPLLNTAVLLASGVTVTWAHHSLIEQDKHNTTAA 160
172088189  81 MILFIVSEICFFFAFFWAFFHSSLAPTPELGCTWPPTGISVLNPFAVPLLNTAVLLASGVTVTWAHHSLMEGSHKETTQA 160
52696462   81 MALFIVSEICFFFAFFWAFFHSSLAPTPELGCTWPPTGIYPLNPFSVPLLNTAVLLASGVTVTWAHHSIIENNKLEVKQA 160
5835195   161 LILTVCLGAYFTFLQAGEYMAAPFSIADSVYGTTFFVATGFHGLHVLIGSSFLAICLARTWSHHFSAGHHFGFEAAAWYW 240
150375682 161 LTLTVLLGGYFTFLQAGEYMAAPFTIADSVYGTTFFVATGFHGLHVLIGSSFLLVCLLRTWLHHFSGGHHFGFEAAAWYW 240
192288381 161 LILTATLGAYFTFLQAGEYLETSFAISDSVYGSTFFVATGFHGLHVLIGSSFLFICLMRTMSHHFSDGHHFGCEAAAWYW 240
192288409 161 LILTVLLGAYFTFLQAGEYIEAPFSIADSMYGSTFFVATGFRGLHVLIGSTFLFICLLRTLTHHFSAGHHFGFEAAAWYW 240
6137773   161 LTLTVILGGYFTFLQLLEYIESPFTIADSVYGATFFVATGFHGLHVIIGSSFLTVCLGRIIMHHFSTSHHFGFEAAAWYW 240
238866913 161 LCLTVILGAYFTFLQAGEYIEAPFTIADSVYGSTFFVATGFHGLHVLIGSSFLFVCLLRTAANHFSSGHHFGFEAAAWYW 240
54310663  161 LLLTVILGAYFTFLQAGEYIEAPFTIADSVYGSTFFVATGFHGLHVLIGSSFLFVCLLRTTANHFSSGHHFGFEAAAWYW 240
172088189 161 LITTVLLGTYFTFLQGTEYWEAPFTIADSVYGATFFVATGFHGLHVLIGSSFLLVCLLRNQLHHYSVGHHFGFEAAAWYW 240
52696462  161 LSLTVMLGAYFTYLQAGEYIEAPFTIADSVYGTTFFVATGFHGLHVLVGSSFLLVCLWRAFSNHFSTGHHFGFEAAAWYW 240
5835195   241 HFVDVVWICLYLCIYWWGS 259
150375682 241 HFVDVVWICLYLCIYWWGS 259
192288381 241 HFVDVVWIFLFICIYWWGS 259
192288409 241 HFVDVVWIFLYMCIYWWGS 259
6137773   241 HFVDVVWIFLYLCIYWWGA 259
238866913 241 HFVDVVWIFLYLCIYWWGS 259
54310663  241 HFVDVVWIFLYLCIYWWGS 259
172088189 241 HFVDVVWIFLYLSIYWWGS 259
52696462  241 HFVDVVWIFLYLCIYWWGS 259
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap