Conserved Protein Domain Family
COX2

?
MTH00008: COX2 
cytochrome c oxidase subunit II; Validated
Statistics
?
PSSM-Id: 164584
View PSSM: MTH00008
Aligned: 6 rows
Threshold Bit Score: 423.498
Threshold Setting Gi: 5835193
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
150375680   1 MPHWGQLMFQDAASSVMLQLISFHDHALIILTLVLTVVAYALTALMFNKYINRYVLEAQTIETVWTVLPALILLGLALPS 80 
5835193     1 MPNWGQVMFQDAASSVMLQLVSFHDHALLVLTLVLTVVGYALLALMLNKQVNRYIMEAQTVETIWTILPALILLVLALPS 80 
192288407   1 MAYWAQLSFQDAASPVMSQLIAFHDHTILVLILVTTIVSYAFFSLFINSYSSRYLLEAQQIETIWTILPAITLLFLAFPS 80 
192288379   1 MAHWAQISLQDAASPLMMQLISFHDHALLILVLVTSVVGYAMTSLTFNSLSNRYILEAQQIETIWTIVPALILLFLAFPS 80 
238866906   1 MSFWGQLNFQDAASPTMMQLIAFHDHAMLILTLVISIVGYAMISIMVNKLSCRTILEAQQIETIWTVIPAIILLFLAFPS 80 
54310656    1 MSFWGQLNFQDAASPTMTQLIAFHDHAMLILTLVISIVGYAMISIMVNKLSCRTILEAQQIETIWTVIPAIILLFLAFPS 80 
150375680  81 LRILYITDEVSNPTLTVKTIGHQWYWSYEYTDFLNVEMDSYMIPTSDLSPGDYRLLEVDNRIVIPMQMEVRMLITAADVL 160
5835193    81 LRILYITDEVSQPSITVKTIGHQWYWSYEYTDFLNVEMDSYMLPTSDLLPGDYRLLEVDNRMVVPMQLEIRMLITAADVI 160
192288407  81 LHLLYLMDEISTPSITMKAIGHQWYWSYEYADFSKLEFDSYMTPDSDLKPGEFRLLEVDHRAVAPMNTEIRILVTAADVL 160
192288379  81 LHLLYLMDEIPNPSITLKTIGHQWYWSYEYSDFSKLDFDSYMLPDTQLSPGQFRLLEVDHRAVLPMNTESRVMVTAADVI 160
238866906  81 LRLLYLMEETMNPNLTLKAIGHQWYWSYEYSDYSDLKFDSYMLPAEDTTTEQFRLLEVDNRAVLPISSEIRVLVTAADVI 160
54310656   81 LRLLYLMEETMNPNLTLKAIGHQWYWSYEYSDYSDLKFDSYMLPAEDTTTEQFRLLEVDNRAVLPISSEIRVLVTAADVI 160
150375680 161 HSWTIPSLGVKVDAVPGRLNQIGFTVSHPGVFYGQCSEICGANHSFMPIAMEVVDSKSFMKWISSFNS 228
5835193   161 HSWTVPALGVKVDAVPGRLNQIGFTTTQPGVFYGQCSEICGANHSFMPIAVEAINTKSFMSWVSNFKP 228
192288407 161 HSWALPSFGLKVDAVPGRLNQLGFTADRPGVFYGQCSEICGANHSFMPIVLEIIDTQTFINWVLKNSS 228
192288379 161 HSWTIPSLGVKIDAIPGRLNQTSFTPNRPGVFYGQCSEICGANHSFMPISLEIVDTNSFIKWILSNTE 228
238866906 161 HSWTVPSLGLKADAIPGRLNQMGVFITRPGVFYGQCSEICGANHSFMPIVIEAVEPSTFMQWTTSLAE 228
54310656  161 HSWTVPSLGVKADAIPGRLNQMGVFISRPGVFYGQCSEICGANHSFMPIVIEAVEPSTFMQWTTSLAE 228
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap