Conserved Protein Domain Family
COX1

?
MTH00007: COX1 
cytochrome c oxidase subunit I; Validated
Statistics
?
PSSM-Id: 133649
View PSSM: MTH00007
Aligned: 7 rows
Threshold Bit Score: 870.761
Threshold Setting Gi: 238866905
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
52696459    1 MRWLYSTNHKDIGTMYFMLGTWGGLLGTSMSLLIRVELGQPGPFLGSDQLYNTIVTAHAFLMIFFMVMPIFIGGFGNWLV 80 
150375679   1 MRWLYSTNHKDIGTLYFILGVWAGMVGAGMSLLIRIELSQPGAFLGSDQLYNTIVTAHAFLMIFFLVMPVFIGGFGNWLL 80 
5835192     1 MRWFYSTNHKDIGTLYFILGVWAGMVGAGMSLLIRIELSQPGAFLGSDQLYNTIVTAHXFVMIFFLVMPVFIGGFGNWLL 80 
54310655    1 MRWLYSTNHKDIGTLYFILGTWGGLLGTSMSLMIRAELGQPGSLLGSDQLYNTIVTAHAFLMIFFLVMPVFIGGFGNWLV 80 
192288378   1 MRWLYSTNHKDIGTLYFILGAWGGLLGTSMSLLIRIELGQPGAYLGSDQLYNTIVTAHAFLMIFFLVMPVFIGGFGNWLI 80 
192288406   1 MRWLFSTNHKDIGTLYFLFGVWGGLLGTSMSLLIRVELGQPGSFLGSDQLYNTIVTAHALLMIFFLVMPILIGGFGNWLI 80 
238866905   1 MRWLYSTNHKDIGTLYFILGTWGGLLGTSMSLMIRAELGQPGSLLGSDQLYNTIVTAHAFLMIFFLVMPVFIGGFGNWLV 80 
52696459   81 PLMLGAPDMAFPRMNNMSFWLLPPSLTLLLASAAVEKGVGTGWTVYPPLSSNLAHAGPSVDLAIFSLHLAGVSSILGAIN 160
150375679  81 PLMLGAPDMAFPRLNNMSFWLLPPSLILLVSSAAVEKGAGTGWTVYPPLASNIAHAGPSVDLAIFSLHLAGASSILGAIN 160
5835192    81 PLMLGAPDMAFPRLNNMSFWLLPPSLILLVSSAAVEKGAGTGWTVYPPLASNLAHAGPSVDLAIFSLHLAGASSILGAIN 160
54310655   81 PLMLGAPDMAFPRLNNMSFWLLPPALTLLVSSALIGGGVGTGWTVYPPLAGNMAHSGPSVDLAIFSLHLAGVSSILGALN 160
192288378  81 PLMLGAPDMAFPRMNNMSFWLLPPALILLVSSAAVEKGVGTGWTVYPPLSDNMAHAGPSVDLAIFSLHLAGISSILGSIN 160
192288406  81 PLMLGAPDMAFPRMNNMSFWLLPPALLLLLSSAAVEKGVGTGWTVYPPLASNLAHAGPSVDLAIFSLHLAGISSILGAIN 160
238866905  81 PLMLGAPDMAFPRLNNMSFWLLPPALTLLVSSALIGGGVGTGWTVYPPLSGNMAHSGPSVDLAIFSLHLAGVSSILGALN 160
52696459  161 FITTAINMRSEGLQLERMPLFVWSVKITAILLLLSLPVLAGAITMLLTDRNLNTAFFDPAGGGDPILYQHLFWFFGHPEV 240
150375679 161 FITTVINMRWSGLRLERIPLFVWAVVITVVLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEV 240
5835192   161 FITTVINMRWSGLRLERIPLFVWAVLITVVLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLFWFFGHPEV 240
54310655  161 FITTVINMRWDGLRPERMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNLNTAFFDPQGGGDPVLYQHLFWFFGHPEV 240
192288378 161 FITTVINMRWKGLRLERVPLFVWAAVITTVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILYQHLFWFFGHPEV 240
192288406 161 FITTVANMRWKGLRLERIPLFVWAVNITVILLLLSLPVLAGAITMLLTDRNVNTSFFDPAGGGDPILYQHLFWFFGHPEV 240
238866905 161 FITTVINMRWDGLRPERMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNLNTAFFDPQGGGDPVLYQHLFWFFGHPEV 240
52696459  241 YILILPAFGAISHIVAHHSGKPEPFGTLGMIYAMSGIGVLGFIVWAHHMFTVGLDVDTRAYFTAATMIIAVPTGIKVFSW 320
150375679 241 YILILPGIRSYFHIVTHYTGKLEPFGALGMIYAMLGIAVLGFIVWAHHMFTVGLDVDTRAYFTAATMIIAVPTGIKVFSW 320
5835192   241 YILILPGFGAISHIVSHYTAKLEPFGALGMIYAMLGIAVLGFIVWAHHMFTVGLDVDTRAYFTAVTMIIAVPTGIKVFSW 320
54310655  241 YILILPGFGAISHIVTQHASKMESFGTLGMIYAMLGIGVLGFIVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKVFSW 320
192288378 241 YILILPGFGAISHIVTHYAGKLEPFGTLGMIYAMLGIGVLGFIVWAHHMYTVGMDVDTRAYFTAATMIIAVPTGIKVFSW 320
192288406 241 YILILPGFGAISHIVAHYAGKLEPFGTLGMIYAMLGIGVLGFIVWAHHMYTVGMDVDTRAYFTAATMIIAVPTGIKVFSW 320
238866905 241 YILILPGFGAISHIVTQHASKMKSFGTLGMIYAMLGIGVLGFIVWAHHMFTVGMDVDTRAYFTAATMIIAVPTGIKVFSW 320
52696459  321 LATISGSPIKTETPMLWALGFIFLFTVGGLTGIVLSNSSLDVILHDTYYVTAHFHYVLSMGAVFALFAGFNYWFPLFTGV 400
150375679 321 LATLHGSKFKYETPMLWALGFIFLFTTGGITGIILSNSSLDIMLHDTYYVVAHFHYVLSMGAVFAIFAAFTHWFPLLSGL 400
5835192   321 LATIHGSKIKYETPVLWALGFIFLFTTGGLTGIILSNSSLDIILHDTYYVVAHFHYVLSMGAVFAIFAAFTHWFPLLTGL 400
54310655  321 LATLHGSPIKYDTPILWALGFIFLFTTGGLTGIVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAMFAAFNHWFPLFTGL 400
192288378 321 LATIFGSRIKYETPMMWALGFIFLFTVGGLTGIMLSNASIDTILHDTYYVTAHFHYVLSMGAVFAMFAAFYHWFPLLSGF 400
192288406 321 LATIFGSQIKYEPAMTWALGFIFLFTMGGLTGIVLSNASLDTMLHDTYYVTAHFHYVLSMGAVFAIFAAFNHWFPLFSGI 400
238866905 321 LATLHGSPIKYDTPILWALGFIFLFTTGGLTGIVLSNSSLDIVLHDTYYVVAHFHYVLSMGAVFAMFAAFNHWFPLFTGL 400
52696459  401 TLHDRWTKIHFLAMFVGVNLTFFPQHFLGLAGMPRRYSDYPDTYLKWNIISSAGSMISFVALLFFIFILWEALSAQRGVI 480
150375679 401 TLHTRWANAQFFLMFLGVNITFFPQHFLSLGGMPRRYSDYPDAFTKWNVVSSLGSLLSFVALMLFIFILWEAFASQRSVL 480
5835192   401 TLHHRWANAQFFLMFLGVNTTFFPQHFLGLSGMPRRYSDYPDAFMKWNVVSSFGSLLSFVALMLFIFILWEAFASQRSVI 480
54310655  401 TLHNRWSKVHFYMMFFGVNLTFFPQHFLGLAGMPRRYSDYPDAMTKWNVVSSIGSMVSFLALILFIFLLWEAFSAQRGVI 480
192288378 401 TLHARWAKAPFIIMFLGVYITFFPQHFLGLSGMPRRYSDYPDAYTKWNIISSFGSMLSFIALLFFIFILWEAFSAQRTVI 480
192288406 401 TLHARWAKIHFFLMFVGVNLTFFPQHFLGLSGMPRRYSDYPXAYTKWNMISSFGSMIPFIALLFFIFILWEAFSAQRPVI 480
238866905 401 TLHDRWSKVHFYMMFFGVNLTFFPQHFLGLAGMPRRYSDYPDAMTKWNVVSSIGSMVSFLALILFIFLLWEAFSAQRGVI 480
52696459  481 AASHLGAALEWQDLapFPLDHHNMPETGLITTP 513
150375679 481 ASPHLPTSMEWADTt-LPLDFHNLSETGIITYP 512
5835192   481 SSPHMSSALEWSDPi-LPLDFHNLSETGIITYP 512
54310655  481 ASPHMSSSLEWQYT--LPLDFHNADETGVITQ- 510
192288378 481 GMSHMSSSLEWQDS--LPLDFHNIPETGITSTP 511
192288406 481 ATSHLPSSMEWQEI--LPLDFHNLPETGVITSS 511
238866905 481 TSPHMSSSLEWQYT--LPLDFHNADETGVITQ- 510
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap