Conserved Protein Domain Family
ATP6

?
MTH00005: ATP6 
ATP synthase F0 subunit 6; Provisional
Statistics
?
PSSM-Id: 164583
View PSSM: MTH00005
Aligned: 9 rows
Threshold Bit Score: 287.4
Threshold Setting Gi: 52696465
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
52696465    1 MLTDIFSALDPATNSFMTtqFTSTLMWLFNFLFIFLLSSSFWITPNRLSTLTSNVASTLYYQSTRTSGNLMKSFPSMISS 80 
150375685   1 MMPDIFSSFDPYSYNTLF--PSNSALMTMNVLMILLPQAGYWTTNSRQLSITTPLKSTIFTQLTRNLYTTFKGSHINHCM 78 
5835198     1 MMPDIFSSFDPYMFNTLF--PLNSLFLVTNTAIILMIQSSFWVLNARTSAFKSPVNDTIFTQLSRTSTTHLKGLSTPLST 78 
6137768     1 MMLDIFSSFDPGINIINNy-MSPLAFWIITSSSIILYSTALWTTPNSFFTSMGALLSTMNDQGNQTHGKHIKGFNSFIVA 79 
172088179   1 MMTDIFSSFDPQTNSLYS--LSPLMFWMLTGSALLITHASFWIHPNTIFWALHSPLNLMHEQASRTFGTHIKGFSSIISA 78 
192288412   1 MLTDIFSSFDPATSSLFNs-LPSPLFWKTNMIIIMIISSSFWIAPSSLSQILSFPKDTMHSQVSRTFGSHLKGFSPLTTS 79 
192288384   1 MLTDIFSSFDPSTISIYNw-APSPIFWFMNFLIMLMLSSMFWLAPSRLHQISSFPKSIMFEQAARTFGKNMKGFAPILSS 79 
238866916   1 MLPDIFSAFDPATSSLFQn-LSSTAFWAFQLSILLVLQTSIWPTPIRQTSLMSYPIHIMHGQMSRTLGKNLKGMTTLVTA 79 
54310666    1 MLPDIFSAFDPATSSLFQn-LSSTAFWAFQLSILLVLQTSIWPTPIRQTSLMSYPIHIMHGQMSRTLGKNLKGMTTLVTA 79 
52696465   81 LFIIIILMNLHGLIPYSFSITSHLIFTLTLGLSLWFAILLSSMMYKPMKFMGSLLPGGAPDWLNPALVIIETISIMVRPI 160
150375685  79 HIYYSDYSNLSGMIPYTFSTSSHLIFTLAIGFPMWLSFILSSASLSPKKTIAHLLPDGAPDWLNPFLVIIETTSIIVHPL 158
5835198    79 IFFMLVMINLMGLIPYMFSTSSHLVFTLSLGFPIWLSLMISTFAHSPKKSTAHFLPDGAPDWLNPFLVLIETTSVFVRPL 158
6137768    80 LFIIIINMNLMGLLPAVFSYSSHLLFTLSFGLPLWLALIMSAIVFNPYSWVAGLLPGGAPHWLNPFLVIIETISISVRPL 159
172088179  79 LFLFLITANLIGLLPYVFSPTSHLLMTLTLGLPLWLSLILTSVSWSPSSFAAHLLPAGAPDWLNPFLVLIETISTCLRPI 158
192288412  80 IFLLLLLINLSGLFPYCFSTSSHLFLTLTLALPLYYHSLYSSFINSPSSFAAGILPSGAPDWLNPFLILAESLSILVRPI 159
192288384  80 LFTLIILVNLSGLLPYVFSTSSHLFFTFSLAIPLWLAMIMSSVTNSPTDFLAGILPGGAPSWLNPFLVLIETTSISVRPI 159
238866916  80 LMTMIILTNLIGLLPYVFSTSSHLIFSVTIGLPLWLSLIMSGVTFNFKMFFAHFVPSSAPNALAPALVLIETLSCLMRPI 159
54310666   80 LMTMIILTNLIGLLPYVFSTSSHLIFSVTIGLPLWLSLIMSGVTFNFKMFFAHFVPSSAPNALAPALVLIETLSCLMRPI 159
52696465  161 TLSFRLAANMSAGHIVLSLMGIYTASALFSSTLAASTLLITQMGYMMFEVGICLIQAYIFTLLLTLYADDHS 232
150375685 159 TLSFRLAANMSAGHIVLSLIGIYCASAWFTSILSSTMLILTSLGYVLFEFAICLIQAYIFCLLLSLYSDDHA 230
5835198   159 TLSFRLAANMSAGHIVLSLMGIYCAAAWFSSVSSTALLILTAIGYILFEVAICLIQAYIFCLLLSLYSDDHA 230
6137768   160 TLSFRLAANMSAGHIVLTLIGTYCAASAFSSIVGLFVLISIQMGYIMFEMGICIIQSYIFCLLLSLYSDDHP 231
172088179 159 TLSFRLAANMSAGHIVLGLMAIYASASLFSPSTSLVLLLITQVFYTLFEVGICLIQAYIFCLLLTLYSDDHP 230
192288412 160 TLSFRLAANMSAGHVVLSLMGIYAASALLYSSFNFIILIAIQAFYMLFEFGICLIQAYIFCLLLSLYADDHT 231
192288384 160 TLSFRLAANMSAGHIVLGLIGIYSASALFTSTISSISLLSIQILYILFEMGICLIQAYIFCLLLSLYSDDHT 231
238866916 160 TLSFRLAANMSAGHIVLTLIGSYAMQAMFSSPSSTILLVFFQTLYIFFEWGICLIQAYIFCLLLSLYADEHP 231
54310666  160 TLSFRLAANMSAGHIVLTLIGSYAMQAMFSSPSSTILLVFFQTLYIFFEWGICLIQAYIFCLLLSLYADEHP 231
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap