Conserved Protein Domain Family
ND4L

?
MTH00001: ND4L 
NADH dehydrogenase subunit 4L; Provisional
Statistics
?
PSSM-Id: 177099
View PSSM: MTH00001
Aligned: 35 rows
Threshold Bit Score: 52.7586
Threshold Setting Gi: 164420818
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
164565471  1 MYYKYLVIIIILFLLGSWGIILNRGHFIIMLVSIELVLLSTFFFFLISSKEIDLLIEQIFMIMGLTIAAAESSIGLAILV 80 
6137785    1 MYYRYMIVAILLLLLGVLGIVLNRGHLIIMLMSIELILLAASFLFLINSMITDTLIEQVFTIMVLTVAAAESSIGLAIMV 80 
124286757  1 MYYKYIIVAILLLLLGVLGIVLNRGHLIIMLMSIELILLAASFLFLINSVVIDILIEQIFTIMILTVAAAESAIGLAILV 80 
115494862  1 MYYKYIIVAILLLLLGVLGIVLNRGHLIIMLMSIELILLAASFLFLINSIVIDILIEQIFTIMILTVAAAESAIGLAILV 80 
107736215  1 --MSYLILSIVILLIGILGIILNRSNLIIMLMCVELVLLASTILLLFESRVLYTLFGQIFAIMILTVAAAESAIGLAIMV 78 
109156448  1 --MSYLILSIVILLIGILGIILNRSNLIIMLMCVELVLLASTILLLFESRVLYTLFGQIFAIVILTVAAAESAIGLAIMV 78 
164420818  1 MLFDFNLLVLIMFCISIIGIIINRSNIILILISIEILLLSVSMNFMLSSLINFSLEGQIIAIYIITIATIESAIGLSIIV 80 
200004084  1 MLFDFNLLVVIMFCISIIGIIINRSNIILILVSIEILLLSISMNFMLTSLTNFSLEGQIIAIYVITIAAIESAIGLSIIV 80 
270267570  1 --MSYLILSIVILLIGILGIILNRSNLIIMLMCVELVLLASTILLLFESRVLYTLFGQIFAIVILTVAAAESAIGLAIMV 78 
189095618  1 --MSYLILSIVILLIGILGIILNRSNLIIMLMCVELVLLASTILLLFESRVLYTLFGQIFAIMILTVAAAESAIGLAIMV 78 
164565471 81 AYYRIRGTIVLKSFSSLRG 99 
6137785   81 AYYRIKGTIAIKSLNWLRG 99 
124286757 81 AYYRIKGTIAVKSLNWLRG 99 
115494862 81 TYYRIRGTIAIKSLNWLRG 99 
107736215 79 NYYRLRGTIAVRALNLLRG 97 
109156448 79 NYYRLRGTIAVRALNLLRG 97 
164420818 81 AFYKIKGSISLKLLNLLKG 99 
200004084 81 AFYKIKGSISLKLLNLLKG 99 
270267570 79 NYYRLRGTIAVRALNLLRG 97 
189095618 79 NYYRLRGTIAVRALNLLRG 97 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap