Conserved Protein Domain Family
argB

?
CHL00202: argB 
acetylglutamate kinase; Provisional
Statistics
?
PSSM-Id: 133644
View PSSM: CHL00202
Aligned: 4 rows
Threshold Bit Score: 470.043
Threshold Setting Gi: 30468179
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
11465420   1 MNNKSIRTQILIEALPYIQQFRGAIFVIKYGGAAMKDLISKERLIADIVFLSCIGLKLVCVHGGGPEINFWLNKMNVESK 80 
51209906   1 MLNNFERVQILSDALPFVQRFHGRTLVVKYGGSAMKNVYLKSKIIEDILFLSYIGIKVVIVHGGGPMINHWLKQVNIQPK 80 
11465794   1 MLTNTERVKVLSD-VTILQKFSSRIIVIKYGGAAMKNQKLKDHVISDLVFLSFIGLRPILVHGGGPEINFWLDQLKILPK 79 
30468179  12 EISDDLRVQVLTEALPYIQKWRNEIMVIKYGGAVVKQ---DADIIKDILFLTCCGFQIVVVHGGGPLINEWLKQLNKSPQ 88 
11465420  81 FHDGIRITDELTMQVVEMVLAGKINKELVSLLNNKGVKGVGLCGKDGTILTARkaQCGSIDmGLVGEIKSVDPYLILTLL 160
51209906  81 FFNGIRVTDKDTMELVEMVLVGKVNKDLVTLLNRSSNLAVGLSGKDANLVVASsfFPDQKD-NYTGKVQQVNIEIVNLLL 159
11465794  80 FENGVRVTDQPTMDIVEMVLVGRVNKDLVASINKQGGKSVGLSGKDGLLITSR--PSDKPNlGFVGEVQNVDTNLLEILI 157
30468179  89 YWEGIRVTDKVTMEIVEMVLAGKVNKQLVGSINANGGKAIGLCGKDANLIVAK--ASSKKElGLVGEIEQIHPQVIDMLL 166
11465420 161 KENYIPVIASVGADETGKTYNINADFVAGEIAASLGAEKLILVTNTSGILADVSQPESLIRDTNIMQLRQLLSRGIISKG 240
51209906 160 SSGYIPVVASVASDLNGQAYNINADSVAGAIAECLNAEKLILLTDTPGIMSDINDPSSLIKYLNISQLEELKSQKIILGG 239
11465794 158 NNNYIPVIASVAADKQGQSYNINADTVAGEIAARLNAEKLILLTDTPGILRNASDATTLISHLSIQEARDLTKTAVISGG 237
30468179 167 EKHYIPVIASVAASHDGTTYNLNADVVAGELAIKLKAKKLIFLTDTKGILADINNENSVISTLNLKEAKNLANT--ISGG 244
11465420 241 MIPKVNCSIRSLAQGVRAVHIIDGTKPHSLLLEVLTNNGIGTRFLY 286
51209906 240 MIPKVDCCIKALQGNVSSAHIIDGSVEHALLLEILTSAGIGSMLVL 285
11465794 238 MIPKVNCCIRSLAQGVASAHILDGRIDHALLLEILTDQGIGSMLVV 283
30468179 245 MIPKVNACICAVENGVEAAHIIGGKEKHQLLLELLTEKGRGSMIVV 290
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap