Conserved Protein Domain Family
syh

?
CHL00201: syh 
histidine-tRNA synthetase; Provisional
Statistics
?
PSSM-Id: 164576
View PSSM: CHL00201
Aligned: 3 rows
Threshold Bit Score: 775.615
Threshold Setting Gi: 51209886
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
90994539   1 MAKIQAIRGTKDILPDEIQYWQFIHNKISKLLECANYQEIRTPIFENSELYDRGIGEDTDIVNKEMYRFHDRSNRDITLR 80 
11465814   1 MAKIQAIRGTKDILPDEQLYWQFIHEKVASLLKYANYKEIKTPIFENSDLYDRGIGENTDIVNKEMYRFNDRSNRDITLR 80 
51209886   3 SYFMQPLRGTKDILPNEINYWHHIHDKALTILSLHNYSEIRTPIIESTSLFKRSIGETSDIINKEMYTFTDQGDRSITLR 82 
90994539  81 PEGTAGIVRSFIENKMSYHHSLQRLWYSGPMFRYERPQSGRQRQFHQLGIEFIGSLDARADSEVIHLAMSIFNNLNLHNL 160
11465814  81 PEGTAGVVRAFIENRMDVQNRLQKLWYSGPMFRYERPQSGRQRQFHQLGIEFIGSSDARADAEIIHLAMNIFNDLSVNDL 160
51209886  83 PEATASIARAFISNKL-YHSNIQRLWYLGPMFRYERPQSGRQRQFHQLGIECIGSINPMADTEVIHLANQLLKELQVKNY 161
90994539 161 KLDLNSIGKVEDRSIYQVKLRDYLTKYHDDLDTDSQKRLTSNPIRILDSKDSNTQKILTEAPKISDFLSLESQQHFGDVC 240
11465814 161 QLDINSIGKAEDRNHYQAKLQEYLEQYYDDLDTDSQNRLSSNPIRILDTKNKYTQTILNDSPRISDFLSLESEKHFDDVC 240
51209886 162 ILEINSIGTLEERQSYKLDLVEYLSQYQQDLDQDSKNRMYSNPLRILDSKNLKTQEILDGAPKLKKYLNKRSTEHFYLVC 241
90994539 241 NYLKLLNIPYNINNKLVRGLDYYNDTAFEIKTLTSKGQDTICGGGRYDSLVHQLGGKATPAVGCAIGLERLLLIAKDNID 320
11465814 241 DYLTLLNVPYKINTQLVRGLDYYNDTAFEIKILKSQGQDTLCGGGRYDSLIHQLGGNKTPAVGCAIGLERLLLVAKDNIL 320
51209886 242 TYLNNLNITYKINYKLVRGLDYYNQTAFEIKTNSKNSQNTICGGGRYDTLIEQLGGPKTPAVGWAIGIERLLKIIEDKLI 321
90994539 321 LPNKSIDFYIATQGTKANETGMQIMRFLHQQFFKIEIDVSSSNFSKQIKQANKKRAVACIIIGSNEIAEGIITIKWLFSQ 400
11465814 321 LPHMSIDCYIVSKGIKARKIGIIITQFLRNQLVKTELDISSSNFGKQLKQAHKKRAIACLILGDNEIQQETITIKWMYTQ 400
51209886 322 LPKQKINVYIATQGLAAQKKIWEIIQALEKKNIKFELDLSNTSFHKQIKKAGKLGAKFCIILGDQEIMDNCVTIKRLDEY 401
90994539 401 KQENITVVQLKHSVSYLKKKILFYKSSKNY 430
11465814 401 EQENMSIIEFKNKISYLKKKIAFNKKFNSY 430
51209886 402 VQYTAQYSNFLQEIHKLQH----------- 420
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap