Conserved Protein Domain Family
infC

?
CHL00199: infC 
translation initiation factor 3; Provisional
Statistics
?
PSSM-Id: 164575
View PSSM: CHL00199
Aligned: 5 rows
Threshold Bit Score: 263.645
Threshold Setting Gi: 30468064
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
90994422   1 MLEKYKNSKKLSRDLPQINDRIRFPKVRVIDDEGEQLGIFVPEEAIQLAVQQGLDLVVVSDKSDPPVCRILDYGKYKFTQ 80 
11465697   1 MLEKYKNSKKLSRDLPQINDRIKFPKVRVIDDEGEQLGIFAPEAAIQLATKQGLDLVLVSDKSDPPVCRILDYGKYKFTQ 80 
11465469   5 ELLKYKSSKE---SHILINENINFPCVRVVDVTGKQLGILDTRQAVEYAKNQGVDLVLVNEISDPPVCKLIDYGKHKFIV 81 
30468064   6 LLMKFQ---------MKLNESIRYASILVIDESGNPLGVFTSEQGRQLAAKKGLDLLLINPNADPPVCKIVNYGKYKFEL 76 
51210011   1 MLDKSKKERKRNEIEPLINERIKYSQIRLIDTSGSQLGIYSSSEALTIALNAGLDLVLISEKSNPPVCRIIDYGKYKFAQ 80 
90994422  81 EKRAREAKKKQHNSSIKEVKMRYKIEEHDYKVRINQASKFIQAGDKVKATITFRGREIQHSNLAIDLLNKMASDLNAIAE 160
11465697  81 EKRAREAKKKQHNSSIKEVKMRYKIEEHDYKVRINQASKFLQSGDKVKATITFRGREIQHSNLAINLLNKMAADLVTIAE 160
11465469  82 EKRVKEGRKKQSGALVKEVKMTYKINEHDYETRLNQAFKFLKSGNKVKVTLTFKGREIQHLSLGTMLLNRLMTDLQQIAE 161
30468064  77 EKKAKAKRKNQ--SQLKEIQMSYNMEEHDYQVRLSQACKFLKAGDKVKVTLMLKGREMQHLELAQNKMAQFQADVSSLAQ 154
51210011  81 EKKAKEAKKKQHNVTIKEVKMRYKIDVHDYNVRINQAFRFLQGGDKVKANVIFRGREIQHTKLAIELLNKMAQDLSHISE 160
90994422 161 IQQAPSRDGRNVIMLLSPKKVS 182
11465697 161 IQQAPSRDGRNVIMLLSPKKVN 182
11465469 162 VKRSPYQDGKTMILILTPKIVD 183
30468064 155 LAKPPSQEGRNLSAIFVPKKS- 175
51210011 161 IQQPPAKDGKNMIMILSPKKI- 181
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap